Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SUA2

Protein Details
Accession A0A2G8SUA2    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
43-62TGDVCKKRCWHYRPAPQQYTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 5, nucl 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MCRRRQVRTLFKNCNHGVTVPDEIVQCYGDNCIFSPNHPSTCTGDVCKKRCWHYRPAPQQYTEEKDAFCPACVKAGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.58
3 0.48
4 0.39
5 0.32
6 0.3
7 0.2
8 0.21
9 0.17
10 0.16
11 0.16
12 0.14
13 0.11
14 0.08
15 0.09
16 0.08
17 0.08
18 0.08
19 0.1
20 0.09
21 0.1
22 0.16
23 0.17
24 0.18
25 0.19
26 0.21
27 0.21
28 0.24
29 0.24
30 0.2
31 0.27
32 0.32
33 0.35
34 0.39
35 0.42
36 0.46
37 0.54
38 0.56
39 0.59
40 0.62
41 0.7
42 0.75
43 0.8
44 0.78
45 0.72
46 0.73
47 0.69
48 0.65
49 0.6
50 0.51
51 0.41
52 0.37
53 0.4
54 0.35
55 0.29
56 0.25
57 0.2
58 0.26