Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SUU4

Protein Details
Accession A0A2G8SUU4    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
166-186LDEKARRKEKETRRRMQQGVRBasic
NLS Segment(s)
PositionSequence
169-179KARRKEKETRR
Subcellular Location(s) cyto 12.5, cyto_nucl 9, cysk 5, nucl 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018961  DnaJ_homolog_subfam-C_membr-28  
Pfam View protein in Pfam  
PF09350  DJC28_CD  
Amino Acid Sequences MPSFTLSHLQMSAKLFEDAALDEAAEEEALRKSSLVSRLENEHENWTGDEPVEHAVLRMLVDKYKPLRGGPIRTAEEKLKTAPPQLWSQDPPLGVVSDVHAAASLTTSSVLEEAPVRTYVPGEPILPGIPGHQPWHTTFTVPSHATSNVRYGNIPPPKPASSSLPLDEKARRKEKETRRRMQQGVRLSQARDSTLDYRLGIKGGAAGQFRRPNPVSLKGWASLVEDRIEKARLAGHFNNVKGRGAPIARTAEDRNPFIGREEFLMNRIVQRQGAAPPWVEIQGELETAVSTFREVLKQSWTRRALRTLTHMHPAELLPHLTLADVAALRDAEWEEKERGYHETALEEVNSLVRKYNGLAPYAVRRAYYMRGTELERVYQEAGEDILRGLEERAQRASGGAPRRRSSFEEDEGGDGVGGNGPSGGPLRLRDMFREMVNAIRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.19
4 0.19
5 0.16
6 0.15
7 0.12
8 0.1
9 0.09
10 0.1
11 0.09
12 0.07
13 0.06
14 0.06
15 0.08
16 0.1
17 0.1
18 0.09
19 0.11
20 0.18
21 0.25
22 0.28
23 0.29
24 0.32
25 0.37
26 0.42
27 0.44
28 0.4
29 0.38
30 0.36
31 0.33
32 0.31
33 0.27
34 0.24
35 0.2
36 0.18
37 0.14
38 0.14
39 0.14
40 0.12
41 0.11
42 0.1
43 0.11
44 0.11
45 0.14
46 0.13
47 0.15
48 0.16
49 0.23
50 0.25
51 0.31
52 0.32
53 0.29
54 0.38
55 0.42
56 0.48
57 0.48
58 0.53
59 0.51
60 0.52
61 0.55
62 0.49
63 0.46
64 0.41
65 0.39
66 0.36
67 0.35
68 0.36
69 0.36
70 0.35
71 0.37
72 0.38
73 0.4
74 0.36
75 0.38
76 0.38
77 0.34
78 0.32
79 0.26
80 0.23
81 0.18
82 0.15
83 0.13
84 0.11
85 0.11
86 0.09
87 0.08
88 0.08
89 0.07
90 0.08
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.06
97 0.06
98 0.06
99 0.08
100 0.08
101 0.09
102 0.1
103 0.1
104 0.1
105 0.11
106 0.11
107 0.13
108 0.13
109 0.12
110 0.12
111 0.13
112 0.13
113 0.12
114 0.11
115 0.1
116 0.12
117 0.12
118 0.14
119 0.14
120 0.16
121 0.18
122 0.23
123 0.22
124 0.2
125 0.2
126 0.21
127 0.26
128 0.24
129 0.23
130 0.2
131 0.22
132 0.22
133 0.22
134 0.25
135 0.21
136 0.21
137 0.21
138 0.21
139 0.28
140 0.34
141 0.34
142 0.31
143 0.33
144 0.34
145 0.35
146 0.35
147 0.32
148 0.29
149 0.31
150 0.31
151 0.29
152 0.29
153 0.3
154 0.34
155 0.35
156 0.39
157 0.44
158 0.43
159 0.46
160 0.55
161 0.63
162 0.68
163 0.72
164 0.72
165 0.73
166 0.8
167 0.81
168 0.77
169 0.73
170 0.7
171 0.64
172 0.6
173 0.53
174 0.45
175 0.42
176 0.36
177 0.3
178 0.23
179 0.21
180 0.19
181 0.18
182 0.19
183 0.16
184 0.17
185 0.16
186 0.15
187 0.12
188 0.09
189 0.09
190 0.09
191 0.12
192 0.11
193 0.11
194 0.16
195 0.21
196 0.22
197 0.26
198 0.26
199 0.26
200 0.29
201 0.35
202 0.32
203 0.3
204 0.32
205 0.26
206 0.25
207 0.22
208 0.21
209 0.15
210 0.14
211 0.13
212 0.11
213 0.11
214 0.12
215 0.13
216 0.1
217 0.1
218 0.12
219 0.12
220 0.18
221 0.18
222 0.23
223 0.25
224 0.26
225 0.3
226 0.28
227 0.27
228 0.22
229 0.21
230 0.18
231 0.16
232 0.16
233 0.16
234 0.17
235 0.18
236 0.2
237 0.22
238 0.24
239 0.26
240 0.26
241 0.24
242 0.22
243 0.21
244 0.21
245 0.2
246 0.15
247 0.14
248 0.16
249 0.14
250 0.14
251 0.16
252 0.14
253 0.14
254 0.16
255 0.15
256 0.13
257 0.13
258 0.14
259 0.14
260 0.17
261 0.16
262 0.14
263 0.14
264 0.15
265 0.15
266 0.13
267 0.11
268 0.1
269 0.09
270 0.09
271 0.08
272 0.07
273 0.06
274 0.06
275 0.07
276 0.04
277 0.04
278 0.05
279 0.06
280 0.08
281 0.1
282 0.11
283 0.19
284 0.26
285 0.3
286 0.38
287 0.43
288 0.46
289 0.48
290 0.53
291 0.48
292 0.44
293 0.48
294 0.46
295 0.43
296 0.46
297 0.43
298 0.37
299 0.36
300 0.33
301 0.28
302 0.22
303 0.19
304 0.11
305 0.11
306 0.11
307 0.09
308 0.09
309 0.06
310 0.06
311 0.06
312 0.06
313 0.06
314 0.06
315 0.06
316 0.07
317 0.08
318 0.08
319 0.1
320 0.13
321 0.15
322 0.15
323 0.16
324 0.17
325 0.2
326 0.21
327 0.22
328 0.19
329 0.18
330 0.19
331 0.19
332 0.18
333 0.15
334 0.12
335 0.12
336 0.12
337 0.11
338 0.12
339 0.12
340 0.12
341 0.14
342 0.21
343 0.2
344 0.21
345 0.22
346 0.23
347 0.3
348 0.33
349 0.32
350 0.25
351 0.24
352 0.26
353 0.29
354 0.32
355 0.27
356 0.26
357 0.28
358 0.31
359 0.36
360 0.34
361 0.33
362 0.28
363 0.28
364 0.26
365 0.23
366 0.2
367 0.15
368 0.14
369 0.11
370 0.11
371 0.08
372 0.07
373 0.07
374 0.07
375 0.08
376 0.12
377 0.15
378 0.17
379 0.19
380 0.2
381 0.2
382 0.2
383 0.24
384 0.26
385 0.33
386 0.37
387 0.42
388 0.46
389 0.5
390 0.53
391 0.53
392 0.55
393 0.53
394 0.51
395 0.49
396 0.46
397 0.44
398 0.4
399 0.36
400 0.27
401 0.19
402 0.14
403 0.11
404 0.1
405 0.07
406 0.07
407 0.06
408 0.08
409 0.09
410 0.1
411 0.1
412 0.12
413 0.19
414 0.25
415 0.27
416 0.3
417 0.34
418 0.36
419 0.35
420 0.37
421 0.32
422 0.34