Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8SNK9

Protein Details
Accession A0A2G8SNK9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
167-201PPCRTWPPRGWVRRGKRGARRRRMDGRKEGREMKQBasic
NLS Segment(s)
PositionSequence
175-204RGWVRRGKRGARRRRMDGRKEGREMKQARK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MHVYCKVSDDVSVPRCPYRSRTTPSVLRPSSSPAPEPEPEPHPTRGPRAACRAGDGRRALSPSEVAYGLVRNSRLGRLLLPRRQHPATVEGVLRPGLGRASIPSSVSPSLLYLLSHPPIVHRLPRPSPSPLRRCRLPWWIMLCLYPMPCGLPRHTRTLTLGSSAADPPCRTWPPRGWVRRGKRGARRRRMDGRKEGREMKQARKNGCKEDSCCRRCCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.38
4 0.41
5 0.42
6 0.47
7 0.49
8 0.54
9 0.58
10 0.64
11 0.69
12 0.73
13 0.65
14 0.58
15 0.52
16 0.52
17 0.51
18 0.45
19 0.4
20 0.33
21 0.37
22 0.36
23 0.38
24 0.35
25 0.32
26 0.34
27 0.36
28 0.36
29 0.37
30 0.38
31 0.41
32 0.45
33 0.46
34 0.47
35 0.51
36 0.54
37 0.48
38 0.49
39 0.5
40 0.45
41 0.47
42 0.43
43 0.37
44 0.32
45 0.34
46 0.3
47 0.24
48 0.22
49 0.16
50 0.16
51 0.14
52 0.12
53 0.11
54 0.12
55 0.11
56 0.12
57 0.12
58 0.11
59 0.13
60 0.13
61 0.14
62 0.14
63 0.16
64 0.23
65 0.31
66 0.35
67 0.38
68 0.41
69 0.45
70 0.45
71 0.44
72 0.36
73 0.32
74 0.29
75 0.27
76 0.24
77 0.18
78 0.18
79 0.17
80 0.15
81 0.11
82 0.08
83 0.06
84 0.05
85 0.05
86 0.05
87 0.08
88 0.08
89 0.09
90 0.09
91 0.11
92 0.11
93 0.11
94 0.11
95 0.08
96 0.09
97 0.08
98 0.08
99 0.07
100 0.09
101 0.09
102 0.1
103 0.09
104 0.09
105 0.12
106 0.14
107 0.17
108 0.19
109 0.24
110 0.28
111 0.32
112 0.34
113 0.37
114 0.45
115 0.49
116 0.55
117 0.57
118 0.6
119 0.6
120 0.6
121 0.6
122 0.6
123 0.54
124 0.5
125 0.47
126 0.43
127 0.4
128 0.37
129 0.32
130 0.25
131 0.22
132 0.17
133 0.12
134 0.11
135 0.14
136 0.16
137 0.18
138 0.26
139 0.28
140 0.35
141 0.36
142 0.37
143 0.36
144 0.39
145 0.36
146 0.29
147 0.27
148 0.2
149 0.21
150 0.21
151 0.19
152 0.17
153 0.16
154 0.17
155 0.22
156 0.26
157 0.26
158 0.31
159 0.37
160 0.43
161 0.53
162 0.58
163 0.61
164 0.68
165 0.74
166 0.79
167 0.81
168 0.82
169 0.82
170 0.85
171 0.87
172 0.87
173 0.87
174 0.85
175 0.87
176 0.88
177 0.87
178 0.88
179 0.87
180 0.85
181 0.84
182 0.83
183 0.77
184 0.77
185 0.73
186 0.72
187 0.71
188 0.69
189 0.7
190 0.72
191 0.73
192 0.72
193 0.74
194 0.72
195 0.68
196 0.72
197 0.74
198 0.71