Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8RP64

Protein Details
Accession A0A2G8RP64    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
146-169GKKRMFKGHKWERTQQERHREQKMBasic
NLS Segment(s)
PositionSequence
147-155KKRMFKGHK
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MAAAMQAVKRFRMRELAPLLRNDAKLSNPRPNVRSPFLPHKSADTGRWSSAKYSLRRQADLVKNARASGTLHLLPPGPKLSLAELATASQAAAASTAQASSSVVEVAEQEAKAKGKKLWDMPVEWKGEYKEKEVKGADVGNRLYAGKKRMFKGHKWERTQQERHREQKMLMRDMKARIERFKTTYRRKTPSPVSVARPVSYSKLPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.46
3 0.51
4 0.5
5 0.51
6 0.55
7 0.51
8 0.5
9 0.43
10 0.36
11 0.33
12 0.38
13 0.41
14 0.45
15 0.47
16 0.53
17 0.54
18 0.6
19 0.62
20 0.58
21 0.59
22 0.57
23 0.6
24 0.59
25 0.59
26 0.52
27 0.5
28 0.51
29 0.46
30 0.43
31 0.39
32 0.37
33 0.36
34 0.38
35 0.34
36 0.29
37 0.34
38 0.37
39 0.35
40 0.41
41 0.46
42 0.48
43 0.49
44 0.49
45 0.51
46 0.52
47 0.56
48 0.51
49 0.47
50 0.44
51 0.43
52 0.4
53 0.32
54 0.25
55 0.19
56 0.19
57 0.15
58 0.15
59 0.15
60 0.16
61 0.16
62 0.17
63 0.16
64 0.11
65 0.11
66 0.11
67 0.12
68 0.15
69 0.15
70 0.14
71 0.12
72 0.12
73 0.12
74 0.11
75 0.09
76 0.05
77 0.05
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.04
84 0.03
85 0.03
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.06
95 0.06
96 0.06
97 0.07
98 0.09
99 0.1
100 0.12
101 0.13
102 0.15
103 0.2
104 0.23
105 0.29
106 0.3
107 0.32
108 0.35
109 0.39
110 0.37
111 0.33
112 0.31
113 0.26
114 0.3
115 0.28
116 0.28
117 0.3
118 0.29
119 0.34
120 0.33
121 0.32
122 0.28
123 0.3
124 0.27
125 0.25
126 0.24
127 0.19
128 0.2
129 0.19
130 0.19
131 0.19
132 0.22
133 0.24
134 0.29
135 0.32
136 0.41
137 0.46
138 0.5
139 0.58
140 0.64
141 0.66
142 0.68
143 0.74
144 0.74
145 0.79
146 0.82
147 0.8
148 0.8
149 0.8
150 0.8
151 0.78
152 0.71
153 0.64
154 0.62
155 0.61
156 0.6
157 0.55
158 0.52
159 0.5
160 0.52
161 0.57
162 0.56
163 0.52
164 0.51
165 0.52
166 0.53
167 0.53
168 0.58
169 0.61
170 0.65
171 0.71
172 0.73
173 0.75
174 0.74
175 0.79
176 0.79
177 0.78
178 0.76
179 0.72
180 0.69
181 0.71
182 0.69
183 0.6
184 0.53
185 0.46
186 0.42