Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SUX3

Protein Details
Accession A0A2G8SUX3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
127-149EGRLAGRRRRSGRRGRDDRHVECBasic
NLS Segment(s)
PositionSequence
130-144LAGRRRRSGRRGRDD
162-162R
Subcellular Location(s) cyto 13, cyto_nucl 10.333, mito_nucl 6.166, nucl 5.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MPPSPIQALLRPEALHGIGVVREPVPDAHRLPQTVILEQLVPVPADTCGASERARIVDEAEDVQRDLGRERAEEVPLQKRGDRRGQEEQLRGRAFLDECVEVLPPRGGGEHGETGDMGDDGGVGLPEGRLAGRRRRSGRRGRDDRHVECVGRRLGWWRGHGRRAGKQERISYMQGLRADTGGSRVLYSPQAAGLLRRVGTAIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.18
3 0.14
4 0.12
5 0.1
6 0.11
7 0.11
8 0.09
9 0.09
10 0.1
11 0.12
12 0.13
13 0.17
14 0.19
15 0.24
16 0.27
17 0.28
18 0.29
19 0.33
20 0.33
21 0.29
22 0.28
23 0.23
24 0.19
25 0.18
26 0.18
27 0.13
28 0.1
29 0.09
30 0.08
31 0.08
32 0.08
33 0.08
34 0.07
35 0.07
36 0.09
37 0.1
38 0.1
39 0.12
40 0.12
41 0.13
42 0.12
43 0.12
44 0.11
45 0.12
46 0.13
47 0.13
48 0.12
49 0.11
50 0.11
51 0.11
52 0.1
53 0.1
54 0.12
55 0.11
56 0.11
57 0.14
58 0.16
59 0.16
60 0.18
61 0.21
62 0.24
63 0.27
64 0.28
65 0.28
66 0.29
67 0.33
68 0.39
69 0.39
70 0.39
71 0.44
72 0.49
73 0.53
74 0.55
75 0.54
76 0.52
77 0.49
78 0.42
79 0.34
80 0.29
81 0.23
82 0.19
83 0.17
84 0.1
85 0.1
86 0.1
87 0.1
88 0.08
89 0.08
90 0.07
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.08
97 0.09
98 0.09
99 0.09
100 0.09
101 0.09
102 0.09
103 0.08
104 0.05
105 0.03
106 0.03
107 0.03
108 0.03
109 0.02
110 0.02
111 0.02
112 0.02
113 0.03
114 0.03
115 0.03
116 0.08
117 0.11
118 0.2
119 0.27
120 0.35
121 0.43
122 0.52
123 0.62
124 0.68
125 0.75
126 0.78
127 0.81
128 0.78
129 0.81
130 0.81
131 0.74
132 0.71
133 0.63
134 0.54
135 0.45
136 0.47
137 0.38
138 0.29
139 0.27
140 0.25
141 0.29
142 0.32
143 0.37
144 0.41
145 0.46
146 0.51
147 0.56
148 0.57
149 0.58
150 0.64
151 0.66
152 0.64
153 0.64
154 0.64
155 0.64
156 0.63
157 0.57
158 0.52
159 0.45
160 0.42
161 0.38
162 0.33
163 0.28
164 0.23
165 0.21
166 0.17
167 0.17
168 0.15
169 0.13
170 0.13
171 0.13
172 0.15
173 0.16
174 0.17
175 0.15
176 0.13
177 0.15
178 0.15
179 0.16
180 0.18
181 0.2
182 0.2
183 0.19