Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8RTC9

Protein Details
Accession A0A2G8RTC9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
69-90REEERKPKSKGRTTRRSKRVLEBasic
NLS Segment(s)
PositionSequence
64-87SGTKTREEERKPKSKGRTTRRSKR
Subcellular Location(s) cyto 14.5, cyto_nucl 13, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013924  RNase_H2_suC  
Gene Ontology GO:0032299  C:ribonuclease H2 complex  
GO:0006401  P:RNA catabolic process  
Pfam View protein in Pfam  
PF08615  RNase_H2_suC  
Amino Acid Sequences MDVDGDENATQDNTTRPRIATSCHFAASFRGRSMHGVEIDLPEGYMGIVLRAPSSDAKGKGTASGTKTREEERKPKSKGRTTRRSKRVLEPEVAEAEDGHEHEDGDGSAPVEDGVTRVLQPVSKFTSFVLWHPDVPVDEARDEYLRSLTEWTRIAAEIHRVEDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.25
4 0.29
5 0.31
6 0.35
7 0.36
8 0.38
9 0.36
10 0.36
11 0.35
12 0.31
13 0.35
14 0.38
15 0.33
16 0.28
17 0.27
18 0.26
19 0.28
20 0.31
21 0.3
22 0.23
23 0.21
24 0.21
25 0.2
26 0.2
27 0.17
28 0.14
29 0.09
30 0.08
31 0.06
32 0.06
33 0.04
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.07
40 0.07
41 0.1
42 0.14
43 0.15
44 0.17
45 0.18
46 0.19
47 0.19
48 0.21
49 0.22
50 0.21
51 0.28
52 0.27
53 0.29
54 0.3
55 0.32
56 0.37
57 0.38
58 0.44
59 0.44
60 0.52
61 0.54
62 0.6
63 0.65
64 0.66
65 0.71
66 0.72
67 0.75
68 0.75
69 0.81
70 0.82
71 0.82
72 0.77
73 0.76
74 0.76
75 0.69
76 0.61
77 0.53
78 0.46
79 0.39
80 0.35
81 0.26
82 0.16
83 0.13
84 0.1
85 0.08
86 0.07
87 0.06
88 0.06
89 0.06
90 0.07
91 0.06
92 0.06
93 0.07
94 0.06
95 0.06
96 0.06
97 0.06
98 0.05
99 0.05
100 0.04
101 0.05
102 0.05
103 0.05
104 0.07
105 0.07
106 0.09
107 0.1
108 0.14
109 0.19
110 0.19
111 0.19
112 0.18
113 0.25
114 0.24
115 0.25
116 0.29
117 0.25
118 0.25
119 0.25
120 0.27
121 0.2
122 0.23
123 0.24
124 0.18
125 0.17
126 0.17
127 0.18
128 0.18
129 0.18
130 0.16
131 0.15
132 0.13
133 0.14
134 0.17
135 0.17
136 0.2
137 0.21
138 0.21
139 0.21
140 0.21
141 0.22
142 0.21
143 0.27
144 0.25