Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AII3

Protein Details
Accession G3AII3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSGIKFSLGKKKKLTKKPNLFNQETPKEHydrophilic
NLS Segment(s)
PositionSequence
10-16KKKKLTK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005634  C:nucleus  
KEGG spaa:SPAPADRAFT_64935  -  
Pfam View protein in Pfam  
PF12656  G-patch_2  
Amino Acid Sequences MSGIKFSLGKKKKLTKKPNLFNQETPKEDNDKDKVEIETYDNKPAPPKKLIIKPDVISHKITSEPLNFGLTTFNRSESTVTSSKLGQVEAESDSDEEYRKVPIEQFGIGFLRGLGYEAEEEEEQVEDKSVEHRQRGVTLGIGADPIAQDLAKDIMKGTPELPLIKKRKIDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.88
4 0.91
5 0.92
6 0.91
7 0.87
8 0.84
9 0.83
10 0.79
11 0.72
12 0.66
13 0.59
14 0.55
15 0.51
16 0.5
17 0.45
18 0.41
19 0.39
20 0.38
21 0.35
22 0.31
23 0.3
24 0.27
25 0.3
26 0.29
27 0.34
28 0.32
29 0.32
30 0.38
31 0.41
32 0.42
33 0.37
34 0.39
35 0.4
36 0.47
37 0.52
38 0.5
39 0.51
40 0.47
41 0.5
42 0.51
43 0.46
44 0.4
45 0.35
46 0.31
47 0.26
48 0.26
49 0.22
50 0.17
51 0.17
52 0.16
53 0.16
54 0.15
55 0.14
56 0.16
57 0.14
58 0.15
59 0.14
60 0.15
61 0.14
62 0.15
63 0.15
64 0.13
65 0.18
66 0.17
67 0.17
68 0.16
69 0.16
70 0.17
71 0.17
72 0.16
73 0.1
74 0.09
75 0.09
76 0.09
77 0.09
78 0.07
79 0.07
80 0.07
81 0.08
82 0.08
83 0.07
84 0.07
85 0.07
86 0.08
87 0.08
88 0.09
89 0.11
90 0.13
91 0.13
92 0.12
93 0.13
94 0.13
95 0.13
96 0.11
97 0.09
98 0.07
99 0.06
100 0.07
101 0.05
102 0.05
103 0.05
104 0.05
105 0.08
106 0.07
107 0.07
108 0.07
109 0.07
110 0.07
111 0.07
112 0.07
113 0.06
114 0.06
115 0.09
116 0.16
117 0.2
118 0.22
119 0.25
120 0.26
121 0.28
122 0.3
123 0.28
124 0.22
125 0.19
126 0.17
127 0.14
128 0.13
129 0.1
130 0.08
131 0.07
132 0.06
133 0.06
134 0.05
135 0.05
136 0.06
137 0.09
138 0.09
139 0.09
140 0.1
141 0.12
142 0.14
143 0.15
144 0.14
145 0.16
146 0.18
147 0.23
148 0.27
149 0.35
150 0.4
151 0.46