Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8RM24

Protein Details
Accession A0A2G8RM24    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
140-172DSDDSRRSRSRSPQRKRYRSESRSRSRSPRARRBasic
NLS Segment(s)
PositionSequence
89-110EKERLKNQDKGEGSSRKRRRSR
145-172RRSRSRSPQRKRYRSESRSRSRSPRARR
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039715  ZCCHC10  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF13917  zf-CCHC_3  
Amino Acid Sequences MSKYAPHCSASSNPRASTTTVCQKCLKTGHFIYECKGSRPYISRPSRTQQLENPKVLAKLKADGKPSVEVPEEFKSKSGTANRILEEKEKERLKNQDKGEGSSRKRRRSRSASSSDSDSDSDSDSDSDSGSSSDSSSASDSDDSRRSRSRSPQRKRYRSESRSRSRSPRARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.44
4 0.41
5 0.41
6 0.42
7 0.4
8 0.43
9 0.45
10 0.44
11 0.47
12 0.49
13 0.44
14 0.41
15 0.41
16 0.46
17 0.47
18 0.47
19 0.43
20 0.46
21 0.44
22 0.39
23 0.39
24 0.31
25 0.3
26 0.34
27 0.39
28 0.4
29 0.47
30 0.5
31 0.53
32 0.58
33 0.62
34 0.61
35 0.59
36 0.56
37 0.59
38 0.59
39 0.55
40 0.51
41 0.44
42 0.42
43 0.39
44 0.34
45 0.24
46 0.23
47 0.28
48 0.3
49 0.31
50 0.3
51 0.31
52 0.3
53 0.3
54 0.27
55 0.22
56 0.18
57 0.19
58 0.22
59 0.21
60 0.2
61 0.19
62 0.19
63 0.17
64 0.22
65 0.22
66 0.22
67 0.25
68 0.28
69 0.28
70 0.28
71 0.28
72 0.27
73 0.26
74 0.24
75 0.27
76 0.27
77 0.27
78 0.29
79 0.38
80 0.41
81 0.45
82 0.44
83 0.45
84 0.43
85 0.45
86 0.49
87 0.47
88 0.47
89 0.5
90 0.56
91 0.58
92 0.64
93 0.68
94 0.7
95 0.71
96 0.76
97 0.76
98 0.76
99 0.72
100 0.67
101 0.64
102 0.55
103 0.47
104 0.38
105 0.29
106 0.21
107 0.17
108 0.15
109 0.12
110 0.11
111 0.1
112 0.09
113 0.08
114 0.08
115 0.07
116 0.07
117 0.07
118 0.07
119 0.06
120 0.07
121 0.07
122 0.08
123 0.09
124 0.09
125 0.1
126 0.11
127 0.12
128 0.16
129 0.23
130 0.24
131 0.29
132 0.35
133 0.38
134 0.44
135 0.54
136 0.6
137 0.64
138 0.73
139 0.79
140 0.84
141 0.9
142 0.9
143 0.9
144 0.9
145 0.89
146 0.89
147 0.89
148 0.88
149 0.87
150 0.88
151 0.87
152 0.87