Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8UD15

Protein Details
Accession J8UD15    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
43-72AFTLTQKRPGQKRKGKKPKVQCYKYKELGYHydrophilic
NLS Segment(s)
PositionSequence
49-61KRPGQKRKGKKPK
Subcellular Location(s) mito 15, cyto_nucl 7.5, nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences KKTPGNISILATKKPVICYKCGQLSHIAAACKIQMDDAKTLTAFTLTQKRPGQKRKGKKPKVQCYKYKELGYIRLAYLKKSKISPPNSIPLFGRSGTGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.32
4 0.34
5 0.37
6 0.42
7 0.47
8 0.45
9 0.42
10 0.39
11 0.38
12 0.38
13 0.36
14 0.29
15 0.22
16 0.21
17 0.2
18 0.15
19 0.13
20 0.1
21 0.09
22 0.11
23 0.13
24 0.13
25 0.13
26 0.13
27 0.13
28 0.11
29 0.1
30 0.08
31 0.09
32 0.17
33 0.17
34 0.24
35 0.28
36 0.33
37 0.41
38 0.5
39 0.58
40 0.59
41 0.69
42 0.73
43 0.81
44 0.86
45 0.86
46 0.89
47 0.89
48 0.91
49 0.88
50 0.86
51 0.83
52 0.83
53 0.81
54 0.72
55 0.66
56 0.58
57 0.56
58 0.5
59 0.44
60 0.35
61 0.35
62 0.33
63 0.31
64 0.34
65 0.32
66 0.32
67 0.33
68 0.41
69 0.44
70 0.49
71 0.55
72 0.54
73 0.6
74 0.58
75 0.57
76 0.5
77 0.44
78 0.42
79 0.33