Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8RWF4

Protein Details
Accession A0A2G8RWF4    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
50-73ASRATRCVTRRMRRDLRRRARGGGBasic
NLS Segment(s)
PositionSequence
59-72RRMRRDLRRRARGG
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
Amino Acid Sequences MRSVARSVVRILGGRARGRGGDASGRTRMVVTGGVRVALYRLARWDRRDASRATRCVTRRMRRDLRRRARGGGTNVGRGMLRDVASSVRRELGRLARGDGARRRSTVGDVPGPMMRVLWRRPSGSRRDAGRRTTLLVTSGVRVTLGRRHRRSGTSRDASRTTSRSIASGMRRDLGRQAGRGGRNTGRGTCWGLPGVVRRELRRRTNRGDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.3
4 0.28
5 0.29
6 0.28
7 0.25
8 0.26
9 0.27
10 0.3
11 0.31
12 0.31
13 0.28
14 0.27
15 0.24
16 0.18
17 0.19
18 0.15
19 0.17
20 0.16
21 0.17
22 0.16
23 0.16
24 0.15
25 0.15
26 0.14
27 0.11
28 0.17
29 0.24
30 0.29
31 0.32
32 0.4
33 0.42
34 0.48
35 0.51
36 0.49
37 0.52
38 0.56
39 0.56
40 0.5
41 0.52
42 0.48
43 0.53
44 0.6
45 0.59
46 0.59
47 0.65
48 0.73
49 0.76
50 0.85
51 0.86
52 0.86
53 0.87
54 0.82
55 0.77
56 0.73
57 0.7
58 0.64
59 0.61
60 0.53
61 0.45
62 0.41
63 0.37
64 0.3
65 0.23
66 0.2
67 0.13
68 0.11
69 0.09
70 0.09
71 0.12
72 0.14
73 0.14
74 0.13
75 0.15
76 0.14
77 0.15
78 0.18
79 0.2
80 0.22
81 0.22
82 0.23
83 0.23
84 0.24
85 0.28
86 0.3
87 0.3
88 0.28
89 0.27
90 0.27
91 0.24
92 0.26
93 0.24
94 0.23
95 0.19
96 0.18
97 0.19
98 0.17
99 0.17
100 0.15
101 0.12
102 0.11
103 0.12
104 0.14
105 0.2
106 0.21
107 0.23
108 0.28
109 0.34
110 0.4
111 0.42
112 0.45
113 0.44
114 0.51
115 0.54
116 0.53
117 0.52
118 0.45
119 0.43
120 0.39
121 0.34
122 0.26
123 0.23
124 0.2
125 0.16
126 0.15
127 0.12
128 0.1
129 0.1
130 0.1
131 0.16
132 0.24
133 0.33
134 0.37
135 0.42
136 0.47
137 0.54
138 0.59
139 0.61
140 0.62
141 0.61
142 0.62
143 0.61
144 0.59
145 0.56
146 0.55
147 0.49
148 0.42
149 0.36
150 0.33
151 0.28
152 0.28
153 0.3
154 0.31
155 0.34
156 0.32
157 0.32
158 0.32
159 0.33
160 0.35
161 0.37
162 0.34
163 0.3
164 0.34
165 0.37
166 0.41
167 0.43
168 0.44
169 0.39
170 0.43
171 0.45
172 0.41
173 0.37
174 0.37
175 0.4
176 0.36
177 0.34
178 0.28
179 0.26
180 0.26
181 0.31
182 0.32
183 0.34
184 0.36
185 0.39
186 0.48
187 0.56
188 0.64
189 0.68
190 0.72