Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SAW5

Protein Details
Accession A0A2G8SAW5   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-95DNFAWGRPSRKQRHTQSKRARSRSTSRARGYHydrophilic
NLS Segment(s)
PositionSequence
72-91PSRKQRHTQSKRARSRSTSR
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MFTKLFPSRSSRRSSGSDRRTSIDSHESGESYVISLPSMHSPLTPPIESASNASSSQPAEMLEDDNFAWGRPSRKQRHTQSKRARSRSTSRARGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.65
4 0.67
5 0.62
6 0.61
7 0.57
8 0.52
9 0.47
10 0.43
11 0.35
12 0.29
13 0.27
14 0.24
15 0.22
16 0.22
17 0.17
18 0.1
19 0.1
20 0.07
21 0.06
22 0.06
23 0.07
24 0.08
25 0.09
26 0.08
27 0.07
28 0.09
29 0.12
30 0.15
31 0.14
32 0.13
33 0.13
34 0.14
35 0.14
36 0.15
37 0.12
38 0.11
39 0.11
40 0.11
41 0.11
42 0.1
43 0.1
44 0.09
45 0.08
46 0.08
47 0.08
48 0.09
49 0.08
50 0.09
51 0.09
52 0.1
53 0.1
54 0.08
55 0.1
56 0.11
57 0.15
58 0.22
59 0.32
60 0.41
61 0.5
62 0.6
63 0.69
64 0.78
65 0.84
66 0.87
67 0.88
68 0.89
69 0.91
70 0.91
71 0.88
72 0.84
73 0.84
74 0.83
75 0.83