Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3PKZ7

Protein Details
Accession J3PKZ7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-85GICPHPPRRHQPIPHLRGRGBasic
NLS Segment(s)
Subcellular Location(s) mito 8, cyto 6, extr 6, cyto_nucl 5, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013154  ADH-like_N  
IPR011032  GroES-like_sf  
Pfam View protein in Pfam  
PF08240  ADH_N  
Amino Acid Sequences MCRILGYEGVSVIDAVGPTSPCSSRATAVLISCITACSTYDYCRRGIYSYCRTGGWILGNVIDGGGICPHPPRRHQPIPHLRGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.07
5 0.08
6 0.1
7 0.11
8 0.11
9 0.15
10 0.16
11 0.15
12 0.16
13 0.18
14 0.17
15 0.17
16 0.17
17 0.14
18 0.13
19 0.12
20 0.11
21 0.08
22 0.07
23 0.07
24 0.09
25 0.1
26 0.12
27 0.17
28 0.18
29 0.19
30 0.19
31 0.2
32 0.18
33 0.21
34 0.26
35 0.28
36 0.31
37 0.31
38 0.31
39 0.31
40 0.3
41 0.28
42 0.22
43 0.16
44 0.13
45 0.12
46 0.12
47 0.11
48 0.1
49 0.08
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.1
56 0.18
57 0.23
58 0.29
59 0.38
60 0.47
61 0.57
62 0.63
63 0.7
64 0.74
65 0.78