Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AUI7

Protein Details
Accession G3AUI7    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
129-149TVTFKNRKLVKRVHVAKKENAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16, cyto_nucl 14, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR039730  Jlp2/Ccd25  
IPR008532  NFACT_RNA-bd  
KEGG spaa:SPAPADRAFT_63384  -  
Pfam View protein in Pfam  
PF05670  NFACT-R_1  
Amino Acid Sequences MVYYFKAKVSTEDDLSDFAIDASNESEEAVIYMGRDKIENDPLIKHSHPKNIWFHVDNYSSAHLYLQLTKKQILDFKQFESFVIEPNLLEQIAQLTKANSIKGNKLNNITVIYTPVENLHTDGSMDIGTVTFKNRKLVKRVHVAKKENAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.23
4 0.17
5 0.12
6 0.11
7 0.09
8 0.09
9 0.09
10 0.08
11 0.08
12 0.08
13 0.08
14 0.06
15 0.07
16 0.06
17 0.05
18 0.05
19 0.07
20 0.08
21 0.09
22 0.09
23 0.1
24 0.14
25 0.2
26 0.22
27 0.21
28 0.22
29 0.24
30 0.28
31 0.27
32 0.3
33 0.29
34 0.35
35 0.36
36 0.4
37 0.44
38 0.45
39 0.49
40 0.44
41 0.42
42 0.38
43 0.38
44 0.32
45 0.28
46 0.24
47 0.19
48 0.18
49 0.15
50 0.11
51 0.1
52 0.15
53 0.16
54 0.18
55 0.19
56 0.2
57 0.21
58 0.22
59 0.25
60 0.24
61 0.28
62 0.26
63 0.27
64 0.29
65 0.28
66 0.26
67 0.27
68 0.23
69 0.17
70 0.16
71 0.14
72 0.11
73 0.11
74 0.12
75 0.07
76 0.07
77 0.05
78 0.06
79 0.06
80 0.07
81 0.07
82 0.07
83 0.11
84 0.12
85 0.13
86 0.15
87 0.17
88 0.23
89 0.29
90 0.34
91 0.34
92 0.37
93 0.37
94 0.35
95 0.35
96 0.3
97 0.24
98 0.21
99 0.18
100 0.15
101 0.14
102 0.13
103 0.12
104 0.11
105 0.12
106 0.11
107 0.1
108 0.1
109 0.09
110 0.09
111 0.08
112 0.07
113 0.06
114 0.05
115 0.06
116 0.07
117 0.12
118 0.15
119 0.18
120 0.26
121 0.33
122 0.4
123 0.47
124 0.56
125 0.6
126 0.66
127 0.75
128 0.78
129 0.81
130 0.8