Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SKB1

Protein Details
Accession A0A2G8SKB1    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-46LLKCLKPSLPWPRRSRRAPRGRARAPSPHydrophilic
NLS Segment(s)
PositionSequence
24-87KPSLPWPRRSRRAPRGRARAPSPRGRCEPARVGKWRGPPLRARRPGCRQARAPGRGRPRLGAPP
96-96R
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
Amino Acid Sequences MSWRGQQAMATAGKGVKRLLKCLKPSLPWPRRSRRAPRGRARAPSPRGRCEPARVGKWRGPPLRARRPGCRQARAPGRGRPRLGAPPQQTVLPARRRPPRTTQSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.22
4 0.22
5 0.3
6 0.38
7 0.43
8 0.47
9 0.54
10 0.57
11 0.54
12 0.62
13 0.65
14 0.64
15 0.66
16 0.7
17 0.71
18 0.75
19 0.8
20 0.82
21 0.82
22 0.84
23 0.85
24 0.86
25 0.87
26 0.84
27 0.82
28 0.77
29 0.76
30 0.71
31 0.7
32 0.66
33 0.61
34 0.58
35 0.56
36 0.51
37 0.47
38 0.49
39 0.45
40 0.46
41 0.44
42 0.45
43 0.45
44 0.5
45 0.54
46 0.49
47 0.46
48 0.49
49 0.54
50 0.6
51 0.65
52 0.63
53 0.63
54 0.69
55 0.75
56 0.74
57 0.72
58 0.65
59 0.65
60 0.7
61 0.69
62 0.66
63 0.64
64 0.66
65 0.66
66 0.64
67 0.57
68 0.52
69 0.54
70 0.55
71 0.56
72 0.51
73 0.5
74 0.49
75 0.47
76 0.44
77 0.4
78 0.42
79 0.42
80 0.44
81 0.46
82 0.55
83 0.6
84 0.65
85 0.7