Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PC51

Protein Details
Accession J3PC51   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
87-108RNTAAARRYRQKRQDRIKELDEHydrophilic
NLS Segment(s)
PositionSequence
83-98RKRERNTAAARRYRQK
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR031106  C/EBP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14686  bZIP  
Amino Acid Sequences MALPDLSDFRVDDHSLGSGLQADMGMGAFNPVHSASAGSSASPTSNNTPGASNTPDAHLNPDEVSHDASSKSPALSSLDFKVRKRERNTAAARRYRQKRQDRIKELDEALAEVTKERDELRLRLARQEAQTATLRDLMGMSASATNRTGLGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.12
5 0.1
6 0.09
7 0.08
8 0.07
9 0.06
10 0.06
11 0.06
12 0.05
13 0.03
14 0.05
15 0.04
16 0.04
17 0.06
18 0.06
19 0.06
20 0.06
21 0.07
22 0.07
23 0.1
24 0.11
25 0.09
26 0.1
27 0.1
28 0.1
29 0.1
30 0.12
31 0.12
32 0.16
33 0.17
34 0.17
35 0.18
36 0.19
37 0.21
38 0.21
39 0.19
40 0.17
41 0.17
42 0.18
43 0.17
44 0.19
45 0.16
46 0.15
47 0.13
48 0.13
49 0.12
50 0.12
51 0.13
52 0.09
53 0.09
54 0.09
55 0.09
56 0.11
57 0.1
58 0.09
59 0.08
60 0.08
61 0.1
62 0.11
63 0.12
64 0.13
65 0.19
66 0.22
67 0.23
68 0.32
69 0.36
70 0.43
71 0.47
72 0.53
73 0.51
74 0.59
75 0.67
76 0.66
77 0.69
78 0.69
79 0.68
80 0.69
81 0.71
82 0.71
83 0.72
84 0.73
85 0.75
86 0.78
87 0.84
88 0.82
89 0.82
90 0.76
91 0.71
92 0.61
93 0.53
94 0.42
95 0.32
96 0.24
97 0.18
98 0.15
99 0.1
100 0.1
101 0.08
102 0.08
103 0.08
104 0.13
105 0.16
106 0.18
107 0.26
108 0.32
109 0.33
110 0.38
111 0.42
112 0.41
113 0.4
114 0.44
115 0.36
116 0.34
117 0.38
118 0.33
119 0.31
120 0.29
121 0.27
122 0.21
123 0.2
124 0.16
125 0.12
126 0.11
127 0.1
128 0.1
129 0.11
130 0.13
131 0.13
132 0.13