Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8RUQ0

Protein Details
Accession A0A2G8RUQ0   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-30RLYSKGRVLGHKRSKRNSRPNTSLLQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, cyto_mito 11.5, cyto 5.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYSKGRVLGHKRSKRNSRPNTSLLQIEGVATKEDAQFYLGKRVAYVYRAKRAVEGSKVRVIWGRVTRPHGNSGVVKGKFSSNLPPHAFGASVRVMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.74
4 0.78
5 0.84
6 0.85
7 0.89
8 0.88
9 0.87
10 0.85
11 0.8
12 0.75
13 0.66
14 0.57
15 0.47
16 0.37
17 0.27
18 0.21
19 0.17
20 0.13
21 0.11
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.09
28 0.1
29 0.11
30 0.18
31 0.18
32 0.18
33 0.17
34 0.19
35 0.18
36 0.19
37 0.26
38 0.22
39 0.27
40 0.29
41 0.29
42 0.29
43 0.31
44 0.31
45 0.31
46 0.31
47 0.29
48 0.31
49 0.31
50 0.3
51 0.3
52 0.28
53 0.27
54 0.28
55 0.3
56 0.3
57 0.37
58 0.41
59 0.41
60 0.44
61 0.39
62 0.37
63 0.33
64 0.35
65 0.37
66 0.32
67 0.3
68 0.27
69 0.27
70 0.26
71 0.27
72 0.31
73 0.27
74 0.35
75 0.37
76 0.39
77 0.39
78 0.37
79 0.36
80 0.26
81 0.26
82 0.19
83 0.17
84 0.14
85 0.14
86 0.13