Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SGW0

Protein Details
Accession A0A2G8SGW0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
146-175ACEAGQSNKPPRRRCPRRLGGIRRRRTWGVHydrophilic
NLS Segment(s)
PositionSequence
154-177KPPRRRCPRRLGGIRRRRTWGVGR
Subcellular Location(s) extr 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR010829  Cerato-platanin  
IPR036908  RlpA-like_sf  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF07249  Cerato-platanin  
CDD cd22778  DPBB_CEPL-like  
Amino Acid Sequences MRSLILAAVVFLLSASVFTQTTQIFNTTIAYDQTYDNGSLSTTGIACSNGINGVIDQNGATILSEIPNWPNISGAPFIAGWNSVNCSSCWELTLGDNFNTVVHLLAVDVAQGGFNVGLNVMNNLTRNNAIDLGRVPATARLVDQTACEAGQSNKPPRRRCPRRLGGIRRRRTWGVGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.06
4 0.06
5 0.07
6 0.1
7 0.11
8 0.13
9 0.13
10 0.15
11 0.14
12 0.14
13 0.15
14 0.13
15 0.13
16 0.13
17 0.13
18 0.13
19 0.12
20 0.13
21 0.14
22 0.13
23 0.12
24 0.11
25 0.1
26 0.09
27 0.09
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.08
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.06
53 0.06
54 0.09
55 0.09
56 0.09
57 0.09
58 0.09
59 0.1
60 0.1
61 0.09
62 0.08
63 0.08
64 0.08
65 0.07
66 0.08
67 0.06
68 0.06
69 0.08
70 0.08
71 0.08
72 0.08
73 0.11
74 0.12
75 0.12
76 0.12
77 0.11
78 0.1
79 0.1
80 0.13
81 0.11
82 0.1
83 0.1
84 0.1
85 0.09
86 0.09
87 0.08
88 0.05
89 0.04
90 0.04
91 0.03
92 0.04
93 0.04
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.04
105 0.04
106 0.05
107 0.05
108 0.06
109 0.07
110 0.08
111 0.09
112 0.1
113 0.11
114 0.12
115 0.14
116 0.13
117 0.14
118 0.15
119 0.16
120 0.16
121 0.15
122 0.14
123 0.13
124 0.14
125 0.13
126 0.13
127 0.11
128 0.12
129 0.13
130 0.13
131 0.13
132 0.12
133 0.12
134 0.11
135 0.11
136 0.13
137 0.2
138 0.27
139 0.35
140 0.41
141 0.49
142 0.57
143 0.65
144 0.74
145 0.78
146 0.8
147 0.82
148 0.85
149 0.88
150 0.92
151 0.93
152 0.92
153 0.92
154 0.92
155 0.87
156 0.84
157 0.76