Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SAZ1

Protein Details
Accession A0A2G8SAZ1   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-31WEGRGVRRTGRSSPRRRRICRLLGRGQDSHydrophilic
NLS Segment(s)
PositionSequence
9-19RRTGRSSPRRR
Subcellular Location(s) plas 11, mito 6, E.R. 3, nucl 2, cyto 2, cyto_nucl 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRWEGRGVRRTGRSSPRRRRICRLLGRGQDSIGYGALGLGLRCSAIVACVVACLCRRLGRRAPRVRVPAVVLGLSRGTILSIGVVRRRSGLRGSGAVRGGGVVTGALCGCRVRPIPSVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.81
4 0.85
5 0.87
6 0.88
7 0.87
8 0.87
9 0.86
10 0.84
11 0.83
12 0.8
13 0.78
14 0.69
15 0.59
16 0.49
17 0.39
18 0.31
19 0.21
20 0.13
21 0.08
22 0.06
23 0.07
24 0.06
25 0.05
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.03
32 0.03
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.06
40 0.06
41 0.07
42 0.11
43 0.14
44 0.19
45 0.27
46 0.36
47 0.46
48 0.54
49 0.59
50 0.61
51 0.64
52 0.6
53 0.53
54 0.46
55 0.38
56 0.3
57 0.25
58 0.17
59 0.13
60 0.11
61 0.1
62 0.08
63 0.05
64 0.05
65 0.04
66 0.04
67 0.04
68 0.06
69 0.08
70 0.12
71 0.13
72 0.14
73 0.16
74 0.18
75 0.19
76 0.21
77 0.23
78 0.23
79 0.27
80 0.29
81 0.31
82 0.3
83 0.28
84 0.25
85 0.2
86 0.17
87 0.11
88 0.09
89 0.05
90 0.04
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.13
98 0.16
99 0.19