Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8S1V3

Protein Details
Accession A0A2G8S1V3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MVNIPKTRRTYCKGKQCRKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKQCRKHTPHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTVCKYKMQLAIKRCKHFELGGEKKTKGAALQFVSILVHVRALQLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.86
4 0.91
5 0.89
6 0.9
7 0.9
8 0.89
9 0.89
10 0.89
11 0.9
12 0.85
13 0.87
14 0.87
15 0.82
16 0.76
17 0.71
18 0.62
19 0.55
20 0.53
21 0.52
22 0.51
23 0.5
24 0.5
25 0.51
26 0.54
27 0.57
28 0.58
29 0.54
30 0.54
31 0.59
32 0.6
33 0.63
34 0.61
35 0.6
36 0.59
37 0.61
38 0.52
39 0.47
40 0.43
41 0.36
42 0.37
43 0.38
44 0.36
45 0.31
46 0.37
47 0.4
48 0.49
49 0.57
50 0.59
51 0.58
52 0.61
53 0.68
54 0.69
55 0.67
56 0.63
57 0.58
58 0.55
59 0.53
60 0.48
61 0.43
62 0.4
63 0.35
64 0.29
65 0.27
66 0.27
67 0.31
68 0.36
69 0.39
70 0.42
71 0.52
72 0.59
73 0.63
74 0.61
75 0.55
76 0.51
77 0.46
78 0.45
79 0.45
80 0.45
81 0.47
82 0.5
83 0.48
84 0.46
85 0.45
86 0.39
87 0.3
88 0.26
89 0.25
90 0.23
91 0.25
92 0.24
93 0.23
94 0.23
95 0.21
96 0.19
97 0.12
98 0.11
99 0.09