Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5XI98

Protein Details
Accession A0A2C5XI98    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-67ARWQRGHSRHTCRHARRDPNIBasic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 7, nucl 5, pero 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000814  TBP  
IPR030491  TBP_CS  
IPR012295  TBP_dom_sf  
IPR033710  TBP_eukaryotic  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF00352  TBP  
PROSITE View protein in PROSITE  
PS00351  TFIID  
CDD cd04516  TBP_eukaryotes  
Amino Acid Sequences MEGIQASRNNPAGRPVIMEGIQTHPSNAAQARAFTAPAPWRQRAAGARWQRGHSRHTCRHARRDPXNIVATVNLDCRLDLKTIALHARNAEYNPKRFAAVIMRIRDPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKLGFNAKFTDFKIQNIVGSCDIKFPIRLEGLASRHHNFSSYEPELFPGLIYRMIKPKIVLLIFVSGKIVLTGAKVREEIYQAFEMIYPVLQDFRKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.27
4 0.26
5 0.26
6 0.23
7 0.24
8 0.27
9 0.24
10 0.22
11 0.19
12 0.19
13 0.22
14 0.21
15 0.21
16 0.18
17 0.19
18 0.21
19 0.21
20 0.21
21 0.17
22 0.21
23 0.22
24 0.29
25 0.35
26 0.34
27 0.35
28 0.35
29 0.41
30 0.4
31 0.41
32 0.43
33 0.45
34 0.51
35 0.54
36 0.57
37 0.58
38 0.56
39 0.58
40 0.58
41 0.59
42 0.59
43 0.64
44 0.71
45 0.72
46 0.79
47 0.81
48 0.82
49 0.77
50 0.78
51 0.72
52 0.67
53 0.63
54 0.53
55 0.43
56 0.35
57 0.31
58 0.23
59 0.21
60 0.15
61 0.11
62 0.11
63 0.12
64 0.11
65 0.1
66 0.09
67 0.09
68 0.12
69 0.16
70 0.16
71 0.15
72 0.16
73 0.17
74 0.18
75 0.18
76 0.25
77 0.26
78 0.28
79 0.3
80 0.29
81 0.28
82 0.27
83 0.27
84 0.24
85 0.27
86 0.3
87 0.3
88 0.32
89 0.34
90 0.35
91 0.34
92 0.3
93 0.23
94 0.21
95 0.18
96 0.16
97 0.14
98 0.15
99 0.14
100 0.13
101 0.12
102 0.09
103 0.08
104 0.07
105 0.07
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.06
112 0.07
113 0.08
114 0.08
115 0.09
116 0.1
117 0.14
118 0.14
119 0.16
120 0.17
121 0.19
122 0.23
123 0.3
124 0.34
125 0.35
126 0.39
127 0.38
128 0.41
129 0.41
130 0.43
131 0.36
132 0.32
133 0.28
134 0.27
135 0.26
136 0.22
137 0.28
138 0.23
139 0.22
140 0.26
141 0.25
142 0.24
143 0.23
144 0.25
145 0.18
146 0.19
147 0.18
148 0.15
149 0.16
150 0.15
151 0.15
152 0.13
153 0.15
154 0.15
155 0.15
156 0.15
157 0.2
158 0.22
159 0.26
160 0.3
161 0.28
162 0.29
163 0.29
164 0.28
165 0.24
166 0.25
167 0.27
168 0.26
169 0.25
170 0.24
171 0.25
172 0.24
173 0.22
174 0.19
175 0.12
176 0.11
177 0.13
178 0.14
179 0.15
180 0.22
181 0.24
182 0.25
183 0.24
184 0.26
185 0.28
186 0.28
187 0.26
188 0.21
189 0.26
190 0.24
191 0.24
192 0.22
193 0.15
194 0.15
195 0.13
196 0.12
197 0.06
198 0.08
199 0.12
200 0.13
201 0.16
202 0.16
203 0.17
204 0.2
205 0.23
206 0.22
207 0.23
208 0.23
209 0.21
210 0.21
211 0.2
212 0.18
213 0.15
214 0.14
215 0.09
216 0.09
217 0.13