Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZDK2

Protein Details
Accession A0A2C5ZDK2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
291-324RGNEAPMKTYKKKDPKRTTRKVNIKPTLSKRPANHydrophilic
NLS Segment(s)
PositionSequence
301-314KKKDPKRTTRKVNI
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021110  DNA_rep_checkpnt_protein  
IPR040203  Sld2  
Gene Ontology GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006270  P:DNA replication initiation  
Pfam View protein in Pfam  
PF11719  Drc1-Sld2  
Amino Acid Sequences MNAEQKLHYESKAKDLRSQLKRWEEEWATANGGSKPGRQDIKSRPDIAAKYKEYNKVRDVLAGKMPPPADRDSGSKRRGQPLPSETPLKRTKHSDAEDEVMKTPSISRKLFSPTKVTWLGPTPQKEGRVLGLLDLLTSTPTQASKHASPRKKDALQTPSKTVHLQATPSKPTPSRSTSPSKRQCHKTTTPRRYRGELALGATPTPPSALHSETPSFLRRRQALAEETESKPLAPLKLPRKPMIRGLSDIVAGLRRVEEEALDEDLEALREVEGGEDGDGLARGETAGEESRGNEAPMKTYKKKDPKRTTRKVNIKPTLSKRPANLTLANDDPESDKSSSSDEDAKEKKNEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.61
4 0.62
5 0.67
6 0.67
7 0.69
8 0.71
9 0.65
10 0.65
11 0.57
12 0.53
13 0.5
14 0.43
15 0.35
16 0.32
17 0.34
18 0.26
19 0.27
20 0.24
21 0.24
22 0.26
23 0.3
24 0.36
25 0.35
26 0.42
27 0.48
28 0.57
29 0.61
30 0.59
31 0.54
32 0.56
33 0.58
34 0.57
35 0.56
36 0.5
37 0.51
38 0.55
39 0.61
40 0.6
41 0.62
42 0.57
43 0.53
44 0.49
45 0.48
46 0.44
47 0.38
48 0.4
49 0.36
50 0.33
51 0.33
52 0.33
53 0.28
54 0.3
55 0.29
56 0.25
57 0.24
58 0.3
59 0.35
60 0.44
61 0.46
62 0.49
63 0.51
64 0.57
65 0.6
66 0.57
67 0.57
68 0.56
69 0.6
70 0.57
71 0.59
72 0.51
73 0.54
74 0.58
75 0.53
76 0.49
77 0.47
78 0.49
79 0.51
80 0.54
81 0.51
82 0.47
83 0.47
84 0.46
85 0.42
86 0.37
87 0.28
88 0.25
89 0.19
90 0.19
91 0.21
92 0.24
93 0.23
94 0.22
95 0.24
96 0.32
97 0.37
98 0.37
99 0.38
100 0.32
101 0.38
102 0.4
103 0.37
104 0.31
105 0.3
106 0.33
107 0.31
108 0.34
109 0.32
110 0.32
111 0.34
112 0.33
113 0.3
114 0.27
115 0.24
116 0.2
117 0.16
118 0.14
119 0.12
120 0.11
121 0.1
122 0.08
123 0.06
124 0.06
125 0.05
126 0.05
127 0.06
128 0.07
129 0.09
130 0.14
131 0.17
132 0.27
133 0.36
134 0.42
135 0.45
136 0.52
137 0.58
138 0.57
139 0.57
140 0.55
141 0.55
142 0.58
143 0.58
144 0.55
145 0.49
146 0.46
147 0.43
148 0.36
149 0.3
150 0.22
151 0.22
152 0.23
153 0.25
154 0.28
155 0.29
156 0.3
157 0.27
158 0.3
159 0.32
160 0.32
161 0.3
162 0.32
163 0.4
164 0.45
165 0.54
166 0.61
167 0.64
168 0.66
169 0.72
170 0.72
171 0.71
172 0.73
173 0.73
174 0.75
175 0.77
176 0.79
177 0.8
178 0.78
179 0.73
180 0.67
181 0.6
182 0.53
183 0.44
184 0.36
185 0.29
186 0.26
187 0.22
188 0.18
189 0.15
190 0.1
191 0.08
192 0.07
193 0.06
194 0.09
195 0.11
196 0.12
197 0.15
198 0.16
199 0.17
200 0.19
201 0.22
202 0.22
203 0.23
204 0.28
205 0.27
206 0.29
207 0.3
208 0.32
209 0.31
210 0.32
211 0.34
212 0.33
213 0.32
214 0.31
215 0.29
216 0.24
217 0.22
218 0.2
219 0.17
220 0.15
221 0.23
222 0.29
223 0.36
224 0.41
225 0.45
226 0.49
227 0.5
228 0.55
229 0.54
230 0.48
231 0.44
232 0.42
233 0.37
234 0.32
235 0.29
236 0.22
237 0.16
238 0.13
239 0.1
240 0.08
241 0.07
242 0.08
243 0.08
244 0.07
245 0.08
246 0.1
247 0.11
248 0.11
249 0.1
250 0.1
251 0.1
252 0.1
253 0.08
254 0.06
255 0.05
256 0.05
257 0.05
258 0.05
259 0.05
260 0.05
261 0.05
262 0.05
263 0.05
264 0.05
265 0.05
266 0.05
267 0.05
268 0.04
269 0.04
270 0.04
271 0.04
272 0.07
273 0.08
274 0.09
275 0.1
276 0.11
277 0.14
278 0.15
279 0.16
280 0.18
281 0.17
282 0.21
283 0.29
284 0.37
285 0.4
286 0.47
287 0.56
288 0.63
289 0.73
290 0.79
291 0.82
292 0.85
293 0.9
294 0.93
295 0.94
296 0.94
297 0.95
298 0.94
299 0.93
300 0.91
301 0.88
302 0.87
303 0.85
304 0.85
305 0.81
306 0.76
307 0.69
308 0.69
309 0.67
310 0.62
311 0.59
312 0.52
313 0.5
314 0.48
315 0.46
316 0.37
317 0.31
318 0.28
319 0.25
320 0.26
321 0.21
322 0.19
323 0.18
324 0.22
325 0.22
326 0.24
327 0.28
328 0.25
329 0.34
330 0.39
331 0.44