Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NMZ0

Protein Details
Accession J3NMZ0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-99IINVHRAQKSRKKRVAMRRGCPTTGHydrophilic
NLS Segment(s)
PositionSequence
83-88KSRKKR
Subcellular Location(s) mito 16, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MAGYGWGHFLVVAGMAEGPLVSTLKNVLRVGDPWALYTPVLGYTHQCSVVSSQALAGRAVVLAVAHLLCDTRVEIINVHRAQKSRKKRVAMRRGCPTTGGLAMWQRPTKACPGTRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.04
5 0.04
6 0.04
7 0.05
8 0.04
9 0.05
10 0.08
11 0.1
12 0.15
13 0.15
14 0.15
15 0.17
16 0.18
17 0.22
18 0.23
19 0.21
20 0.18
21 0.19
22 0.18
23 0.16
24 0.16
25 0.11
26 0.09
27 0.1
28 0.09
29 0.1
30 0.11
31 0.13
32 0.13
33 0.13
34 0.11
35 0.12
36 0.14
37 0.13
38 0.1
39 0.1
40 0.11
41 0.12
42 0.11
43 0.1
44 0.07
45 0.07
46 0.06
47 0.05
48 0.03
49 0.02
50 0.03
51 0.03
52 0.02
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.05
59 0.06
60 0.06
61 0.08
62 0.1
63 0.19
64 0.2
65 0.23
66 0.24
67 0.26
68 0.33
69 0.42
70 0.51
71 0.54
72 0.6
73 0.65
74 0.73
75 0.81
76 0.85
77 0.85
78 0.83
79 0.83
80 0.8
81 0.73
82 0.65
83 0.55
84 0.47
85 0.38
86 0.3
87 0.22
88 0.21
89 0.24
90 0.29
91 0.29
92 0.27
93 0.28
94 0.3
95 0.35
96 0.39
97 0.43