Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YEQ3

Protein Details
Accession A0A2C5YEQ3   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
271-297RNSNQDPRLRSRRVRRMAKLNTRKSVQHydrophilic
NLS Segment(s)
PositionSequence
282-286RRVRR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MAAAQIPRPPYPPMSYHTPQSNSPASVPSPSQHDQHRSLYGQPPSQHLQQSMYYQPQPHYQSLPSHPAASPYAQHAHHPQQQPMTSQPNIIMSHSAPQNQMNQHAQAGMTGSPRPKIEPQVPVQLPRQAQASPIPQTQHQHSAPPLQSPGNPATGVNPNAAPGPIPATTPLVVRQDGNGVQWIAFEYSRDRVKMEYTIRCDVESVDTNALSAEFRQENCVYPRACCPKEQYRGNRLLYETDCNRVGWSLAELNPPLRGKRGLIQRAVDSWRNSNQDPRLRSRRVRRMAKLNTRKSVQGTPTPHPGAAHLPGPAGPSGMPAAPPMGPAGTPALGKPGLGGMGQAMHHHAGGHHDGGAAGGDDVGMFHQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.46
4 0.51
5 0.5
6 0.47
7 0.5
8 0.5
9 0.43
10 0.41
11 0.39
12 0.32
13 0.32
14 0.32
15 0.27
16 0.3
17 0.3
18 0.33
19 0.37
20 0.43
21 0.44
22 0.47
23 0.51
24 0.46
25 0.49
26 0.52
27 0.51
28 0.49
29 0.46
30 0.47
31 0.46
32 0.49
33 0.47
34 0.41
35 0.38
36 0.35
37 0.38
38 0.38
39 0.39
40 0.37
41 0.36
42 0.37
43 0.41
44 0.43
45 0.41
46 0.39
47 0.37
48 0.4
49 0.42
50 0.48
51 0.41
52 0.39
53 0.36
54 0.36
55 0.34
56 0.29
57 0.25
58 0.22
59 0.26
60 0.24
61 0.27
62 0.3
63 0.36
64 0.42
65 0.45
66 0.44
67 0.45
68 0.47
69 0.47
70 0.46
71 0.44
72 0.37
73 0.33
74 0.31
75 0.3
76 0.28
77 0.26
78 0.23
79 0.17
80 0.22
81 0.23
82 0.24
83 0.21
84 0.22
85 0.27
86 0.27
87 0.32
88 0.28
89 0.27
90 0.25
91 0.25
92 0.22
93 0.16
94 0.16
95 0.12
96 0.11
97 0.13
98 0.13
99 0.15
100 0.16
101 0.19
102 0.21
103 0.25
104 0.29
105 0.33
106 0.36
107 0.44
108 0.44
109 0.45
110 0.44
111 0.43
112 0.38
113 0.33
114 0.31
115 0.21
116 0.21
117 0.22
118 0.24
119 0.22
120 0.24
121 0.25
122 0.25
123 0.28
124 0.3
125 0.33
126 0.29
127 0.28
128 0.27
129 0.33
130 0.31
131 0.3
132 0.29
133 0.22
134 0.22
135 0.23
136 0.23
137 0.18
138 0.17
139 0.15
140 0.16
141 0.19
142 0.19
143 0.17
144 0.15
145 0.14
146 0.14
147 0.14
148 0.11
149 0.07
150 0.08
151 0.08
152 0.08
153 0.08
154 0.1
155 0.1
156 0.1
157 0.13
158 0.13
159 0.13
160 0.13
161 0.12
162 0.13
163 0.13
164 0.13
165 0.12
166 0.1
167 0.09
168 0.09
169 0.09
170 0.07
171 0.07
172 0.07
173 0.07
174 0.11
175 0.12
176 0.13
177 0.13
178 0.12
179 0.14
180 0.19
181 0.24
182 0.25
183 0.29
184 0.32
185 0.32
186 0.31
187 0.3
188 0.25
189 0.22
190 0.19
191 0.16
192 0.13
193 0.13
194 0.12
195 0.12
196 0.12
197 0.08
198 0.06
199 0.08
200 0.09
201 0.09
202 0.13
203 0.14
204 0.17
205 0.19
206 0.24
207 0.21
208 0.21
209 0.29
210 0.34
211 0.34
212 0.34
213 0.39
214 0.43
215 0.51
216 0.59
217 0.59
218 0.59
219 0.66
220 0.65
221 0.61
222 0.53
223 0.48
224 0.42
225 0.39
226 0.33
227 0.28
228 0.27
229 0.24
230 0.23
231 0.19
232 0.17
233 0.11
234 0.12
235 0.12
236 0.13
237 0.15
238 0.15
239 0.16
240 0.19
241 0.2
242 0.19
243 0.18
244 0.18
245 0.18
246 0.24
247 0.34
248 0.36
249 0.39
250 0.4
251 0.39
252 0.42
253 0.45
254 0.43
255 0.36
256 0.34
257 0.36
258 0.38
259 0.37
260 0.4
261 0.44
262 0.46
263 0.49
264 0.54
265 0.57
266 0.61
267 0.68
268 0.72
269 0.75
270 0.77
271 0.82
272 0.81
273 0.82
274 0.85
275 0.88
276 0.88
277 0.86
278 0.83
279 0.75
280 0.71
281 0.65
282 0.61
283 0.55
284 0.53
285 0.5
286 0.48
287 0.54
288 0.52
289 0.48
290 0.41
291 0.37
292 0.33
293 0.3
294 0.27
295 0.19
296 0.18
297 0.18
298 0.19
299 0.17
300 0.13
301 0.11
302 0.1
303 0.11
304 0.11
305 0.1
306 0.09
307 0.11
308 0.1
309 0.11
310 0.11
311 0.1
312 0.09
313 0.1
314 0.12
315 0.12
316 0.12
317 0.12
318 0.16
319 0.15
320 0.15
321 0.14
322 0.12
323 0.12
324 0.11
325 0.11
326 0.07
327 0.1
328 0.11
329 0.11
330 0.13
331 0.13
332 0.13
333 0.13
334 0.13
335 0.16
336 0.19
337 0.19
338 0.17
339 0.16
340 0.16
341 0.16
342 0.16
343 0.11
344 0.07
345 0.06
346 0.05
347 0.05
348 0.05