Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PEB1

Protein Details
Accession J3PEB1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
92-116PKYRPEPNYKPPKSFKPPKSAPASSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR000307  Ribosomal_S16  
IPR020592  Ribosomal_S16_CS  
IPR023803  Ribosomal_S16_dom_sf  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00886  Ribosomal_S16  
PROSITE View protein in PROSITE  
PS00732  RIBOSOMAL_S16  
Amino Acid Sequences MVVKMRLARFGRTNAPFFNIVVAQARTARNSKPMEVIGTYDPIPKTDSYDTSRKLHKDIRLDMTRAKYWIGVGAQPTDTVWRLLSMVGIVPPKYRPEPNYKPPKSFKPPKSAPASSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.39
4 0.34
5 0.32
6 0.23
7 0.19
8 0.19
9 0.18
10 0.16
11 0.19
12 0.19
13 0.2
14 0.23
15 0.23
16 0.27
17 0.29
18 0.29
19 0.28
20 0.28
21 0.28
22 0.25
23 0.26
24 0.2
25 0.19
26 0.18
27 0.18
28 0.17
29 0.15
30 0.16
31 0.14
32 0.17
33 0.17
34 0.2
35 0.21
36 0.27
37 0.3
38 0.32
39 0.37
40 0.34
41 0.36
42 0.38
43 0.38
44 0.38
45 0.39
46 0.43
47 0.42
48 0.42
49 0.41
50 0.4
51 0.36
52 0.3
53 0.26
54 0.18
55 0.15
56 0.16
57 0.13
58 0.11
59 0.11
60 0.12
61 0.12
62 0.12
63 0.12
64 0.11
65 0.11
66 0.1
67 0.09
68 0.08
69 0.08
70 0.08
71 0.08
72 0.07
73 0.07
74 0.08
75 0.1
76 0.1
77 0.11
78 0.13
79 0.17
80 0.21
81 0.26
82 0.28
83 0.37
84 0.46
85 0.55
86 0.65
87 0.66
88 0.7
89 0.73
90 0.78
91 0.79
92 0.8
93 0.78
94 0.77
95 0.79
96 0.8
97 0.82
98 0.76