Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PBW2

Protein Details
Accession J3PBW2    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
31-50AKNLKNRPRVPERARKKGSNBasic
165-184TFVGSLKGCKRKKGRWTRNIHydrophilic
NLS Segment(s)
PositionSequence
35-47KNRPRVPERARKK
176-177KK
Subcellular Location(s) mito 13, cyto 9.5, cyto_nucl 7.5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MPASYRYCGQSIMAKLKNKVKFKLYESVWSAKNLKNRPRVPERARKKGSNVIGAYRYTGVNGIVLICLTTKIASIKHYTLRIIIFKKGQTNRVIFIILLGINNFLQRERVANTHVKQRKSGICFGGRFIGSESFAAALVARFTLFFSGGLFAAAVKARRGVISETFVGSLKGCKRKKGRWTRNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.56
4 0.63
5 0.62
6 0.62
7 0.6
8 0.6
9 0.6
10 0.63
11 0.57
12 0.57
13 0.55
14 0.55
15 0.5
16 0.47
17 0.46
18 0.41
19 0.47
20 0.47
21 0.51
22 0.55
23 0.59
24 0.63
25 0.68
26 0.75
27 0.75
28 0.77
29 0.78
30 0.79
31 0.8
32 0.76
33 0.72
34 0.7
35 0.67
36 0.64
37 0.56
38 0.5
39 0.46
40 0.42
41 0.37
42 0.3
43 0.25
44 0.16
45 0.15
46 0.11
47 0.08
48 0.08
49 0.07
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.06
59 0.07
60 0.09
61 0.13
62 0.15
63 0.18
64 0.2
65 0.19
66 0.2
67 0.21
68 0.24
69 0.22
70 0.23
71 0.22
72 0.22
73 0.29
74 0.3
75 0.32
76 0.32
77 0.32
78 0.3
79 0.28
80 0.27
81 0.19
82 0.17
83 0.13
84 0.09
85 0.07
86 0.06
87 0.06
88 0.05
89 0.06
90 0.06
91 0.05
92 0.06
93 0.06
94 0.08
95 0.09
96 0.11
97 0.14
98 0.21
99 0.22
100 0.32
101 0.37
102 0.37
103 0.37
104 0.41
105 0.44
106 0.42
107 0.46
108 0.41
109 0.41
110 0.4
111 0.4
112 0.39
113 0.32
114 0.28
115 0.24
116 0.21
117 0.16
118 0.15
119 0.14
120 0.1
121 0.09
122 0.09
123 0.07
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.06
133 0.07
134 0.08
135 0.08
136 0.08
137 0.07
138 0.06
139 0.08
140 0.1
141 0.1
142 0.1
143 0.12
144 0.12
145 0.13
146 0.15
147 0.17
148 0.19
149 0.22
150 0.23
151 0.22
152 0.23
153 0.23
154 0.21
155 0.18
156 0.21
157 0.25
158 0.33
159 0.35
160 0.44
161 0.53
162 0.62
163 0.73
164 0.78