Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZN46

Protein Details
Accession A0A2C5ZN46    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
72-91ACASCKKTGCDKKDNKPLPAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 13.166, nucl 11.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MSCHNRFRTNYLKIDRRDSYESCMAACDVMPECRSVEYEPRTKKCFYGTNTEHPTISAKAFLSAHSLGCAGACASCKKTGCDKKDNKPLPADAARCDDDPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.64
3 0.61
4 0.59
5 0.52
6 0.49
7 0.46
8 0.43
9 0.34
10 0.32
11 0.26
12 0.2
13 0.18
14 0.13
15 0.09
16 0.11
17 0.11
18 0.11
19 0.11
20 0.12
21 0.13
22 0.13
23 0.19
24 0.22
25 0.3
26 0.36
27 0.4
28 0.43
29 0.43
30 0.42
31 0.4
32 0.41
33 0.36
34 0.39
35 0.39
36 0.44
37 0.48
38 0.48
39 0.43
40 0.36
41 0.36
42 0.26
43 0.23
44 0.15
45 0.1
46 0.12
47 0.12
48 0.12
49 0.14
50 0.14
51 0.13
52 0.12
53 0.12
54 0.1
55 0.09
56 0.09
57 0.05
58 0.06
59 0.07
60 0.09
61 0.11
62 0.16
63 0.18
64 0.21
65 0.31
66 0.4
67 0.46
68 0.54
69 0.61
70 0.67
71 0.77
72 0.81
73 0.75
74 0.71
75 0.67
76 0.64
77 0.63
78 0.55
79 0.48
80 0.47
81 0.45