Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5Z349

Protein Details
Accession A0A2C5Z349    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
47-80IHFATLKPEQKKKKKKKEKKEKPAKANKIKDNGABasic
NLS Segment(s)
PositionSequence
54-81PEQKKKKKKKEKKEKPAKANKIKDNGAS
Subcellular Location(s) cyto 8, extr 7, cyto_nucl 6, E.R. 5, nucl 2, mito 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANFDFLKSVGATQEAVAVLNDQPKVFATIIAVLIGLTVELGILAAIHFATLKPEQKKKKKKKEKKEKPAKANKIKDNGASAPGRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.1
5 0.1
6 0.1
7 0.13
8 0.14
9 0.11
10 0.11
11 0.12
12 0.15
13 0.13
14 0.12
15 0.1
16 0.1
17 0.11
18 0.1
19 0.1
20 0.06
21 0.06
22 0.05
23 0.04
24 0.02
25 0.02
26 0.02
27 0.01
28 0.02
29 0.01
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.06
38 0.08
39 0.15
40 0.21
41 0.29
42 0.4
43 0.51
44 0.62
45 0.71
46 0.8
47 0.86
48 0.91
49 0.94
50 0.96
51 0.96
52 0.97
53 0.97
54 0.96
55 0.96
56 0.96
57 0.95
58 0.95
59 0.93
60 0.9
61 0.86
62 0.8
63 0.72
64 0.67
65 0.58
66 0.54