Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5ZFH0

Protein Details
Accession A0A2C5ZFH0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-72AQSQATRGRRNKSYRKGRYPYPDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, mito_nucl 12, extr 3
Family & Domain DBs
Amino Acid Sequences MKFSAVLAFLTSVGLVSSHMRLQPRGAKSKNLNGAKIVSTIKGSIGRAIAQSQATRGRRNKSYRKGRYPYPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.1
6 0.13
7 0.14
8 0.15
9 0.19
10 0.26
11 0.3
12 0.37
13 0.38
14 0.42
15 0.45
16 0.52
17 0.57
18 0.52
19 0.47
20 0.39
21 0.39
22 0.32
23 0.3
24 0.23
25 0.15
26 0.12
27 0.12
28 0.12
29 0.13
30 0.12
31 0.11
32 0.12
33 0.12
34 0.12
35 0.13
36 0.14
37 0.13
38 0.13
39 0.15
40 0.23
41 0.25
42 0.32
43 0.38
44 0.43
45 0.5
46 0.6
47 0.68
48 0.7
49 0.78
50 0.81
51 0.86
52 0.85