Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5ZC66

Protein Details
Accession A0A2C5ZC66    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRKPMGPKRVCHEHPBasic
NLS Segment(s)
PositionSequence
3-15KRKKSSRKPMGPK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPMGPKRVCHEHPILEFDTEVNSQTDPLPTMFTCLFCNHEKSVTVKLDRKAGVGQLDCRICGQKFQCAVNYAVAKQDTTETRMYEHTAPSSSNEQRQRGLRDTDGDVDQDRRSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.85
4 0.76
5 0.72
6 0.66
7 0.62
8 0.56
9 0.53
10 0.47
11 0.37
12 0.34
13 0.28
14 0.24
15 0.18
16 0.16
17 0.12
18 0.1
19 0.1
20 0.11
21 0.11
22 0.1
23 0.1
24 0.11
25 0.1
26 0.13
27 0.13
28 0.14
29 0.14
30 0.14
31 0.18
32 0.17
33 0.21
34 0.18
35 0.19
36 0.2
37 0.2
38 0.26
39 0.26
40 0.28
41 0.3
42 0.31
43 0.34
44 0.33
45 0.32
46 0.26
47 0.24
48 0.23
49 0.19
50 0.19
51 0.18
52 0.18
53 0.17
54 0.17
55 0.18
56 0.14
57 0.19
58 0.18
59 0.19
60 0.22
61 0.23
62 0.25
63 0.25
64 0.27
65 0.26
66 0.26
67 0.21
68 0.21
69 0.2
70 0.17
71 0.16
72 0.18
73 0.15
74 0.17
75 0.19
76 0.16
77 0.18
78 0.19
79 0.22
80 0.21
81 0.21
82 0.2
83 0.19
84 0.19
85 0.21
86 0.27
87 0.28
88 0.34
89 0.39
90 0.4
91 0.44
92 0.5
93 0.53
94 0.51
95 0.52
96 0.47
97 0.44
98 0.45
99 0.44
100 0.39
101 0.34
102 0.31
103 0.29