Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5YXJ0

Protein Details
Accession A0A2C5YXJ0    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
117-143VPPRPSVRLRGTHRQRRRRAGDNSHVTHydrophilic
NLS Segment(s)
PositionSequence
125-135LRGTHRQRRRR
Subcellular Location(s) mito 8, cyto 7, plas 5, pero 2, nucl 1, extr 1, E.R. 1, cysk 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGKPSAPGSASDSPSARLTEPRSAISLHGPSSAPYRDDPAATDNDDDDDDELPPLYSEHDEYHDEGPLVDPLVPPGTGPLVSPFGHDSEGAVAYYMDRRLDSDPVFLADHIRRLAVVPPRPSVRLRGTHRQRRRRAGDNSHVTGGDDVVVDFDIRIELTHLLYADIRRQQAWRALVTAGNFEKVRRGTVFPDRAPGFGGAPGGDVERDGVPGLEQWCHRFCASPARLRCFSLERRIVGWDWDLLRRRLEGLVRASNYRGHAVVSFPIGNAQADIYSDCRPNRWRLTGWIRFIFYASLLFLITWPWLFLRTRRWETVAAEWYVSMPTSVPGRRQYAAGVSEERWYALWAPAIQRAMLDRRDGLLDQGDLERARSEVAGAGVGAAMGVVDRSFGWGGDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.28
4 0.28
5 0.3
6 0.35
7 0.36
8 0.36
9 0.35
10 0.34
11 0.34
12 0.35
13 0.33
14 0.26
15 0.27
16 0.25
17 0.24
18 0.29
19 0.3
20 0.25
21 0.22
22 0.26
23 0.25
24 0.26
25 0.26
26 0.25
27 0.26
28 0.26
29 0.26
30 0.21
31 0.21
32 0.2
33 0.19
34 0.16
35 0.13
36 0.11
37 0.11
38 0.1
39 0.09
40 0.09
41 0.08
42 0.09
43 0.1
44 0.11
45 0.13
46 0.16
47 0.18
48 0.21
49 0.22
50 0.22
51 0.2
52 0.19
53 0.18
54 0.15
55 0.14
56 0.12
57 0.1
58 0.1
59 0.11
60 0.11
61 0.09
62 0.1
63 0.1
64 0.1
65 0.1
66 0.11
67 0.13
68 0.14
69 0.15
70 0.16
71 0.16
72 0.16
73 0.16
74 0.13
75 0.12
76 0.13
77 0.11
78 0.1
79 0.08
80 0.09
81 0.11
82 0.12
83 0.1
84 0.09
85 0.12
86 0.13
87 0.18
88 0.18
89 0.18
90 0.17
91 0.19
92 0.19
93 0.17
94 0.2
95 0.16
96 0.19
97 0.17
98 0.16
99 0.14
100 0.15
101 0.2
102 0.23
103 0.28
104 0.28
105 0.32
106 0.35
107 0.37
108 0.38
109 0.38
110 0.37
111 0.4
112 0.44
113 0.51
114 0.59
115 0.67
116 0.76
117 0.81
118 0.83
119 0.85
120 0.84
121 0.83
122 0.82
123 0.81
124 0.81
125 0.78
126 0.72
127 0.63
128 0.56
129 0.47
130 0.37
131 0.27
132 0.17
133 0.09
134 0.06
135 0.05
136 0.05
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.05
145 0.06
146 0.06
147 0.06
148 0.07
149 0.08
150 0.09
151 0.12
152 0.15
153 0.15
154 0.16
155 0.16
156 0.19
157 0.23
158 0.25
159 0.21
160 0.19
161 0.19
162 0.19
163 0.19
164 0.2
165 0.15
166 0.15
167 0.14
168 0.13
169 0.16
170 0.15
171 0.17
172 0.15
173 0.17
174 0.18
175 0.27
176 0.33
177 0.28
178 0.34
179 0.33
180 0.31
181 0.3
182 0.27
183 0.19
184 0.14
185 0.13
186 0.07
187 0.07
188 0.07
189 0.06
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.04
197 0.04
198 0.06
199 0.07
200 0.09
201 0.09
202 0.12
203 0.13
204 0.15
205 0.15
206 0.15
207 0.15
208 0.23
209 0.27
210 0.32
211 0.35
212 0.39
213 0.41
214 0.41
215 0.42
216 0.37
217 0.37
218 0.39
219 0.39
220 0.33
221 0.33
222 0.34
223 0.32
224 0.28
225 0.24
226 0.18
227 0.15
228 0.2
229 0.22
230 0.21
231 0.22
232 0.21
233 0.21
234 0.21
235 0.21
236 0.21
237 0.23
238 0.27
239 0.28
240 0.28
241 0.28
242 0.28
243 0.28
244 0.24
245 0.19
246 0.14
247 0.13
248 0.13
249 0.13
250 0.13
251 0.12
252 0.1
253 0.11
254 0.11
255 0.1
256 0.09
257 0.08
258 0.06
259 0.06
260 0.07
261 0.08
262 0.11
263 0.15
264 0.15
265 0.19
266 0.23
267 0.3
268 0.36
269 0.38
270 0.38
271 0.43
272 0.53
273 0.56
274 0.59
275 0.55
276 0.5
277 0.45
278 0.43
279 0.34
280 0.25
281 0.18
282 0.12
283 0.09
284 0.08
285 0.07
286 0.06
287 0.07
288 0.07
289 0.06
290 0.06
291 0.06
292 0.09
293 0.11
294 0.14
295 0.23
296 0.32
297 0.38
298 0.4
299 0.43
300 0.44
301 0.46
302 0.51
303 0.47
304 0.38
305 0.32
306 0.3
307 0.27
308 0.23
309 0.2
310 0.12
311 0.07
312 0.08
313 0.13
314 0.15
315 0.2
316 0.25
317 0.3
318 0.3
319 0.31
320 0.31
321 0.31
322 0.31
323 0.29
324 0.27
325 0.24
326 0.26
327 0.25
328 0.24
329 0.18
330 0.17
331 0.16
332 0.15
333 0.17
334 0.17
335 0.19
336 0.24
337 0.24
338 0.23
339 0.22
340 0.24
341 0.26
342 0.26
343 0.27
344 0.23
345 0.23
346 0.26
347 0.26
348 0.24
349 0.21
350 0.19
351 0.18
352 0.18
353 0.2
354 0.17
355 0.18
356 0.16
357 0.13
358 0.14
359 0.12
360 0.11
361 0.11
362 0.11
363 0.11
364 0.1
365 0.09
366 0.08
367 0.08
368 0.07
369 0.04
370 0.03
371 0.03
372 0.03
373 0.03
374 0.04
375 0.04
376 0.07
377 0.08
378 0.08