Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YXJ0

Protein Details
Accession A0A2C5YXJ0   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
117-143VPPRPSVRLRGTHRQRRRRAGDNSHVTHydrophilic
NLS Segment(s)
PositionSequence
125-135LRGTHRQRRRR
Subcellular Location(s) mito 8, cyto 7, plas 5, pero 2, nucl 1, extr 1, E.R. 1, cysk 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGKPSAPGSASDSPSARLTEPRSAISLHGPSSAPYRDDPAATDNDDDDDDELPPLYSEHDEYHDEGPLVDPLVPPGTGPLVSPFGHDSEGAVAYYMDRRLDSDPVFLADHIRRLAVVPPRPSVRLRGTHRQRRRRAGDNSHVTGGDDVVVDFDIRIELTHLLYADIRRQQAWRALVTAGNFEKVRRGTVFPDRAPGFGGAPGGDVERDGVPGLEQWCHRFCASPARLRCFSLERRIVGWDWDLLRRRLEGLVRASNYRGHAVVSFPIGNAQADIYSDCRPNRWRLTGWIRFIFYASLLFLITWPWLFLRTRRWETVAAEWYVSMPTSVPGRRQYAAGVSEERWYALWAPAIQRAMLDRRDGLLDQGDLERARSEVAGAGVGAAMGVVDRSFGWGGDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.28
4 0.28
5 0.3
6 0.35
7 0.36
8 0.36
9 0.35
10 0.34
11 0.34
12 0.35
13 0.33
14 0.26
15 0.27
16 0.25
17 0.24
18 0.29
19 0.3
20 0.25
21 0.22
22 0.26
23 0.25
24 0.26
25 0.26
26 0.25
27 0.26
28 0.26
29 0.26
30 0.21
31 0.21
32 0.2
33 0.19
34 0.16
35 0.13
36 0.11
37 0.11
38 0.1
39 0.09
40 0.09
41 0.08
42 0.09
43 0.1
44 0.11
45 0.13
46 0.16
47 0.18
48 0.21
49 0.22
50 0.22
51 0.2
52 0.19
53 0.18
54 0.15
55 0.14
56 0.12
57 0.1
58 0.1
59 0.11
60 0.11
61 0.09
62 0.1
63 0.1
64 0.1
65 0.1
66 0.11
67 0.13
68 0.14
69 0.15
70 0.16
71 0.16
72 0.16
73 0.16
74 0.13
75 0.12
76 0.13
77 0.11
78 0.1
79 0.08
80 0.09
81 0.11
82 0.12
83 0.1
84 0.09
85 0.12
86 0.13
87 0.18
88 0.18
89 0.18
90 0.17
91 0.19
92 0.19
93 0.17
94 0.2
95 0.16
96 0.19
97 0.17
98 0.16
99 0.14
100 0.15
101 0.2
102 0.23
103 0.28
104 0.28
105 0.32
106 0.35
107 0.37
108 0.38
109 0.38
110 0.37
111 0.4
112 0.44
113 0.51
114 0.59
115 0.67
116 0.76
117 0.81
118 0.83
119 0.85
120 0.84
121 0.83
122 0.82
123 0.81
124 0.81
125 0.78
126 0.72
127 0.63
128 0.56
129 0.47
130 0.37
131 0.27
132 0.17
133 0.09
134 0.06
135 0.05
136 0.05
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.05
145 0.06
146 0.06
147 0.06
148 0.07
149 0.08
150 0.09
151 0.12
152 0.15
153 0.15
154 0.16
155 0.16
156 0.19
157 0.23
158 0.25
159 0.21
160 0.19
161 0.19
162 0.19
163 0.19
164 0.2
165 0.15
166 0.15
167 0.14
168 0.13
169 0.16
170 0.15
171 0.17
172 0.15
173 0.17
174 0.18
175 0.27
176 0.33
177 0.28
178 0.34
179 0.33
180 0.31
181 0.3
182 0.27
183 0.19
184 0.14
185 0.13
186 0.07
187 0.07
188 0.07
189 0.06
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.04
197 0.04
198 0.06
199 0.07
200 0.09
201 0.09
202 0.12
203 0.13
204 0.15
205 0.15
206 0.15
207 0.15
208 0.23
209 0.27
210 0.32
211 0.35
212 0.39
213 0.41
214 0.41
215 0.42
216 0.37
217 0.37
218 0.39
219 0.39
220 0.33
221 0.33
222 0.34
223 0.32
224 0.28
225 0.24
226 0.18
227 0.15
228 0.2
229 0.22
230 0.21
231 0.22
232 0.21
233 0.21
234 0.21
235 0.21
236 0.21
237 0.23
238 0.27
239 0.28
240 0.28
241 0.28
242 0.28
243 0.28
244 0.24
245 0.19
246 0.14
247 0.13
248 0.13
249 0.13
250 0.13
251 0.12
252 0.1
253 0.11
254 0.11
255 0.1
256 0.09
257 0.08
258 0.06
259 0.06
260 0.07
261 0.08
262 0.11
263 0.15
264 0.15
265 0.19
266 0.23
267 0.3
268 0.36
269 0.38
270 0.38
271 0.43
272 0.53
273 0.56
274 0.59
275 0.55
276 0.5
277 0.45
278 0.43
279 0.34
280 0.25
281 0.18
282 0.12
283 0.09
284 0.08
285 0.07
286 0.06
287 0.07
288 0.07
289 0.06
290 0.06
291 0.06
292 0.09
293 0.11
294 0.14
295 0.23
296 0.32
297 0.38
298 0.4
299 0.43
300 0.44
301 0.46
302 0.51
303 0.47
304 0.38
305 0.32
306 0.3
307 0.27
308 0.23
309 0.2
310 0.12
311 0.07
312 0.08
313 0.13
314 0.15
315 0.2
316 0.25
317 0.3
318 0.3
319 0.31
320 0.31
321 0.31
322 0.31
323 0.29
324 0.27
325 0.24
326 0.26
327 0.25
328 0.24
329 0.18
330 0.17
331 0.16
332 0.15
333 0.17
334 0.17
335 0.19
336 0.24
337 0.24
338 0.23
339 0.22
340 0.24
341 0.26
342 0.26
343 0.27
344 0.23
345 0.23
346 0.26
347 0.26
348 0.24
349 0.21
350 0.19
351 0.18
352 0.18
353 0.2
354 0.17
355 0.18
356 0.16
357 0.13
358 0.14
359 0.12
360 0.11
361 0.11
362 0.11
363 0.11
364 0.1
365 0.09
366 0.08
367 0.08
368 0.07
369 0.04
370 0.03
371 0.03
372 0.03
373 0.03
374 0.04
375 0.04
376 0.07
377 0.08
378 0.08