Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZH85

Protein Details
Accession A0A2C5ZH85   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-32LSRASRPLFRHPPRFRPNPRSGSRRWHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 10, E.R. 2, cyto 1, extr 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR005336  MPC  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0006850  P:mitochondrial pyruvate transmembrane transport  
Pfam View protein in Pfam  
PF03650  MPC  
Amino Acid Sequences MLPAASLSRASRPLFRHPPRFRPNPRSGSRRWQSSAAHAQQGWFKRMWESEVGFKTVHFWAPVMKWALVLAGISDFARPAEKLSMPQNFALTCTGLIWTRWCLIIKPKNYLLAAVNFFLGIVGVIQLTRIGIYKSSQNDSPVEKVKKTVEEKIDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.58
3 0.65
4 0.68
5 0.76
6 0.79
7 0.86
8 0.86
9 0.85
10 0.86
11 0.84
12 0.84
13 0.81
14 0.77
15 0.78
16 0.74
17 0.72
18 0.65
19 0.61
20 0.55
21 0.56
22 0.6
23 0.53
24 0.5
25 0.42
26 0.4
27 0.4
28 0.41
29 0.35
30 0.26
31 0.23
32 0.21
33 0.22
34 0.23
35 0.22
36 0.2
37 0.25
38 0.26
39 0.27
40 0.24
41 0.23
42 0.23
43 0.2
44 0.19
45 0.12
46 0.11
47 0.11
48 0.12
49 0.16
50 0.16
51 0.14
52 0.13
53 0.13
54 0.13
55 0.1
56 0.09
57 0.06
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.06
67 0.08
68 0.08
69 0.1
70 0.15
71 0.19
72 0.19
73 0.2
74 0.2
75 0.18
76 0.19
77 0.17
78 0.13
79 0.09
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.1
87 0.11
88 0.12
89 0.12
90 0.22
91 0.29
92 0.31
93 0.35
94 0.37
95 0.4
96 0.39
97 0.39
98 0.32
99 0.3
100 0.28
101 0.23
102 0.21
103 0.15
104 0.15
105 0.13
106 0.1
107 0.05
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.04
116 0.05
117 0.06
118 0.07
119 0.09
120 0.15
121 0.2
122 0.24
123 0.26
124 0.28
125 0.31
126 0.34
127 0.38
128 0.42
129 0.43
130 0.4
131 0.42
132 0.44
133 0.5
134 0.51
135 0.54