FuNGI

A0A2C5XYK1

Protein Details

Accession

A0A2C5XYK1

Localization Confidence

Low

Confidence Score

7.1

NoLS Segment(s)

Position	Sequence	Protein Nature
17-37	IHYHYRPPEIKPQHHRFDCRS	Basic

NLS Segment(s)

Subcellular Location(s)

cyto 10.5, cyto_nucl 9.5, nucl 7.5, mito 5, plas 1, pero 1, golg 1, cysk 1

Family & Domain DBs

InterPro	View protein in InterPro IPR046357 PPIase_dom_sf
Gene Ontology	GO:0003755 F:peptidyl-prolyl cis-trans isomerase activity

Amino Acid Sequences

MTTRPGEESLITAFGDIHYHYRPPEIKPQHHRFDCRSYVYLFEDVVNARCRLEIANNPGTEEQDAFTGYFDQTHLHYSLWHHQCRVSITVPESVDPNEWHLPTYDLRNENIYHYKLHSLDIYFSAHQDAVLFVDHVKRAFAMSSGDERAQLQQPAVMSPLVQKLERVAVSDNQYEYGLSDPPATSQPERTTAASLDASANALPPSGPKAEYQPMAYNPAAPAAPEIIRHRDKTPPPDDDPVNPLAVAVAQDLHAASHDPSAQERSQRPRDRHTFMGPGKVILRQPVPQPTPPGTGSGAAPGTFSQQHQSWQASQDYSIHRQVYQPVESEMQQAYQSKKEPKGKFEEHAGRLERGVSVMRVAPFVVVLASLFTNLVTAAEKLQIDTTLQVKCDRKTTKGDSVSMHYKGTLKSSGEKFDAIFETELVAIAGVPKPEKIETITPDTPIAEKVGSIVSDAADAAKTMMMDTDDVQSHEEL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.12
2	0.13
3	0.12
4	0.14
5	0.15
6	0.17
7	0.18
8	0.26
9	0.29
10	0.33
11	0.43
12	0.49
13	0.56
14	0.65
15	0.74
16	0.77
17	0.81
18	0.83
19	0.79
20	0.78
21	0.76
22	0.71
23	0.64
24	0.55
25	0.51
26	0.47
27	0.42
28	0.33
29	0.26
30	0.23
31	0.22
32	0.25
33	0.25
34	0.21
35	0.2
36	0.19
37	0.2
38	0.19
39	0.23
40	0.26
41	0.31
42	0.37
43	0.37
44	0.39
45	0.39
46	0.39
47	0.34
48	0.27
49	0.19
50	0.13
51	0.14
52	0.11
53	0.11
54	0.12
55	0.1
56	0.1
57	0.1
58	0.11
59	0.11
60	0.14
61	0.15
62	0.13
63	0.15
64	0.19
65	0.29
66	0.36
67	0.38
68	0.36
69	0.37
70	0.4
71	0.41
72	0.41
73	0.34
74	0.3
75	0.29
76	0.33
77	0.32
78	0.29
79	0.27
80	0.24
81	0.24
82	0.2
83	0.23
84	0.22
85	0.21
86	0.21
87	0.2
88	0.22
89	0.21
90	0.26
91	0.28
92	0.26
93	0.27
94	0.3
95	0.3
96	0.32
97	0.36
98	0.32
99	0.27
100	0.27
101	0.3
102	0.27
103	0.28
104	0.25
105	0.2
106	0.21
107	0.21
108	0.22
109	0.18
110	0.18
111	0.18
112	0.15
113	0.14
114	0.12
115	0.1
116	0.08
117	0.08
118	0.08
119	0.07
120	0.1
121	0.11
122	0.11
123	0.11
124	0.1
125	0.1
126	0.1
127	0.11
128	0.09
129	0.11
130	0.14
131	0.16
132	0.16
133	0.16
134	0.17
135	0.19
136	0.2
137	0.18
138	0.15
139	0.14
140	0.14
141	0.14
142	0.15
143	0.11
144	0.08
145	0.1
146	0.14
147	0.14
148	0.14
149	0.13
150	0.14
151	0.18
152	0.18
153	0.17
154	0.15
155	0.17
156	0.21
157	0.23
158	0.22
159	0.19
160	0.19
161	0.17
162	0.15
163	0.13
164	0.1
165	0.08
166	0.09
167	0.08
168	0.09
169	0.12
170	0.14
171	0.14
172	0.17
173	0.18
174	0.21
175	0.23
176	0.23
177	0.22
178	0.2
179	0.21
180	0.17
181	0.16
182	0.12
183	0.1
184	0.1
185	0.08
186	0.09
187	0.06
188	0.06
189	0.05
190	0.05
191	0.07
192	0.08
193	0.09
194	0.09
195	0.13
196	0.17
197	0.18
198	0.2
199	0.2
200	0.2
201	0.24
202	0.23
203	0.2
204	0.17
205	0.17
206	0.15
207	0.11
208	0.11
209	0.08
210	0.08
211	0.09
212	0.11
213	0.17
214	0.2
215	0.22
216	0.23
217	0.29
218	0.32
219	0.39
220	0.42
221	0.41
222	0.42
223	0.44
224	0.44
225	0.38
226	0.38
227	0.3
228	0.25
229	0.19
230	0.15
231	0.11
232	0.1
233	0.08
234	0.05
235	0.04
236	0.04
237	0.04
238	0.04
239	0.04
240	0.04
241	0.05
242	0.05
243	0.06
244	0.07
245	0.07
246	0.08
247	0.12
248	0.13
249	0.18
250	0.22
251	0.3
252	0.39
253	0.46
254	0.49
255	0.54
256	0.6
257	0.6
258	0.59
259	0.55
260	0.54
261	0.48
262	0.52
263	0.42
264	0.37
265	0.33
266	0.31
267	0.28
268	0.22
269	0.22
270	0.17
271	0.2
272	0.27
273	0.29
274	0.28
275	0.32
276	0.32
277	0.34
278	0.32
279	0.31
280	0.24
281	0.22
282	0.2
283	0.18
284	0.15
285	0.11
286	0.11
287	0.09
288	0.11
289	0.11
290	0.11
291	0.12
292	0.13
293	0.15
294	0.18
295	0.2
296	0.2
297	0.22
298	0.24
299	0.21
300	0.21
301	0.23
302	0.24
303	0.27
304	0.29
305	0.27
306	0.25
307	0.26
308	0.31
309	0.31
310	0.28
311	0.25
312	0.22
313	0.23
314	0.23
315	0.24
316	0.19
317	0.16
318	0.16
319	0.18
320	0.18
321	0.21
322	0.26
323	0.3
324	0.38
325	0.47
326	0.49
327	0.53
328	0.6
329	0.6
330	0.58
331	0.6
332	0.61
333	0.54
334	0.58
335	0.54
336	0.45
337	0.41
338	0.38
339	0.29
340	0.21
341	0.19
342	0.12
343	0.11
344	0.13
345	0.13
346	0.13
347	0.12
348	0.11
349	0.1
350	0.1
351	0.08
352	0.05
353	0.04
354	0.05
355	0.05
356	0.05
357	0.05
358	0.05
359	0.05
360	0.05
361	0.06
362	0.06
363	0.06
364	0.07
365	0.1
366	0.1
367	0.11
368	0.12
369	0.12
370	0.11
371	0.13
372	0.16
373	0.15
374	0.16
375	0.23
376	0.26
377	0.28
378	0.36
379	0.38
380	0.39
381	0.46
382	0.52
383	0.55
384	0.56
385	0.59
386	0.53
387	0.56
388	0.58
389	0.51
390	0.44
391	0.36
392	0.34
393	0.31
394	0.32
395	0.3
396	0.26
397	0.32
398	0.35
399	0.39
400	0.37
401	0.37
402	0.33
403	0.32
404	0.32
405	0.26
406	0.23
407	0.18
408	0.17
409	0.16
410	0.15
411	0.11
412	0.09
413	0.06
414	0.07
415	0.09
416	0.1
417	0.1
418	0.11
419	0.14
420	0.15
421	0.17
422	0.19
423	0.24
424	0.28
425	0.36
426	0.37
427	0.36
428	0.37
429	0.36
430	0.32
431	0.27
432	0.24
433	0.15
434	0.13
435	0.13
436	0.14
437	0.13
438	0.13
439	0.12
440	0.1
441	0.1
442	0.11
443	0.1
444	0.08
445	0.08
446	0.08
447	0.08
448	0.08
449	0.07
450	0.09
451	0.09
452	0.1
453	0.11
454	0.15
455	0.16
456	0.17

A0A2C5XYK1

3D AlphaFold-predicted Structure Viewer