Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YMN8

Protein Details
Accession A0A2C5YMN8   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
185-220DLDGPPQKKKKPAPIPVKEKKERKGNKRRNRQTSRGBasic
NLS Segment(s)
PositionSequence
190-220PQKKKKPAPIPVKEKKERKGNKRRNRQTSRG
Subcellular Location(s) nucl 20, cyto 3, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR023584  Ribosome_recyc_fac_dom  
IPR036191  RRF_sf  
Pfam View protein in Pfam  
PF01765  RRF  
Amino Acid Sequences MLTEHLNHIAAYWRPKIADAIANGHFNVEAMGDVPVQPHSLLPPVDPPTPLRELAHVVPRGKTTILLLVHDMRDVKRIRRAILKSPFNYRPPLNYDNVREITVKLEGEPREERIRRIKDLYQLWYRDIRIARFKQERLIKTLRQDGDLLPDDYRKARAVHMRIQGITIQSIQVEEKAWRQAQRIDLDGPPQKKKKPAPIPVKEKKERKGNKRRNRQTSRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.29
4 0.27
5 0.28
6 0.25
7 0.28
8 0.29
9 0.3
10 0.29
11 0.27
12 0.23
13 0.18
14 0.15
15 0.09
16 0.06
17 0.05
18 0.06
19 0.06
20 0.06
21 0.07
22 0.08
23 0.08
24 0.08
25 0.08
26 0.09
27 0.12
28 0.13
29 0.13
30 0.18
31 0.22
32 0.23
33 0.24
34 0.24
35 0.26
36 0.28
37 0.29
38 0.23
39 0.21
40 0.23
41 0.25
42 0.31
43 0.31
44 0.29
45 0.3
46 0.3
47 0.3
48 0.26
49 0.23
50 0.16
51 0.17
52 0.17
53 0.16
54 0.17
55 0.18
56 0.18
57 0.18
58 0.18
59 0.13
60 0.19
61 0.21
62 0.22
63 0.27
64 0.29
65 0.31
66 0.38
67 0.42
68 0.45
69 0.52
70 0.56
71 0.52
72 0.57
73 0.59
74 0.53
75 0.54
76 0.45
77 0.39
78 0.38
79 0.39
80 0.35
81 0.34
82 0.34
83 0.35
84 0.35
85 0.33
86 0.27
87 0.23
88 0.21
89 0.19
90 0.16
91 0.11
92 0.15
93 0.13
94 0.17
95 0.17
96 0.19
97 0.25
98 0.26
99 0.28
100 0.33
101 0.36
102 0.35
103 0.38
104 0.38
105 0.38
106 0.41
107 0.44
108 0.41
109 0.38
110 0.37
111 0.36
112 0.33
113 0.31
114 0.29
115 0.27
116 0.29
117 0.3
118 0.37
119 0.39
120 0.4
121 0.42
122 0.48
123 0.47
124 0.45
125 0.49
126 0.44
127 0.43
128 0.5
129 0.43
130 0.37
131 0.37
132 0.3
133 0.3
134 0.3
135 0.26
136 0.19
137 0.19
138 0.19
139 0.19
140 0.2
141 0.16
142 0.15
143 0.19
144 0.26
145 0.3
146 0.37
147 0.42
148 0.43
149 0.41
150 0.41
151 0.38
152 0.31
153 0.27
154 0.2
155 0.13
156 0.1
157 0.11
158 0.1
159 0.09
160 0.1
161 0.1
162 0.13
163 0.19
164 0.22
165 0.24
166 0.27
167 0.31
168 0.36
169 0.38
170 0.38
171 0.35
172 0.33
173 0.37
174 0.42
175 0.43
176 0.46
177 0.49
178 0.51
179 0.57
180 0.64
181 0.67
182 0.71
183 0.76
184 0.78
185 0.81
186 0.87
187 0.88
188 0.91
189 0.9
190 0.88
191 0.86
192 0.86
193 0.86
194 0.86
195 0.87
196 0.88
197 0.89
198 0.92
199 0.94
200 0.95