Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NL95

Protein Details
Accession J3NL95    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-35HPHIPQPPPGKDRRHKRPHDSQATPRLSBasic
NLS Segment(s)
PositionSequence
18-23KDRRHK
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MVRGLALHPHIPQPPPGKDRRHKRPHDSQATPRLSSPGSISPSAFFATSLPPPPISRTTQAAQPPHQLHAQIPVPRPHPLIRVVRTTQLRQRHHTRGHPSWEGPQRPYGDHSRPGLPDQLQQSRLPRDVGARKLRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.52
4 0.58
5 0.64
6 0.73
7 0.78
8 0.81
9 0.83
10 0.85
11 0.89
12 0.89
13 0.9
14 0.86
15 0.84
16 0.84
17 0.79
18 0.7
19 0.6
20 0.51
21 0.41
22 0.34
23 0.29
24 0.24
25 0.22
26 0.22
27 0.22
28 0.2
29 0.21
30 0.21
31 0.17
32 0.12
33 0.09
34 0.11
35 0.12
36 0.13
37 0.13
38 0.14
39 0.14
40 0.17
41 0.2
42 0.21
43 0.21
44 0.23
45 0.23
46 0.27
47 0.32
48 0.32
49 0.3
50 0.34
51 0.33
52 0.31
53 0.3
54 0.26
55 0.21
56 0.23
57 0.25
58 0.22
59 0.24
60 0.26
61 0.27
62 0.28
63 0.3
64 0.26
65 0.25
66 0.27
67 0.31
68 0.3
69 0.34
70 0.34
71 0.38
72 0.4
73 0.42
74 0.42
75 0.45
76 0.47
77 0.48
78 0.55
79 0.57
80 0.61
81 0.65
82 0.67
83 0.65
84 0.67
85 0.65
86 0.58
87 0.58
88 0.6
89 0.56
90 0.49
91 0.48
92 0.43
93 0.4
94 0.43
95 0.42
96 0.38
97 0.4
98 0.41
99 0.41
100 0.4
101 0.41
102 0.42
103 0.36
104 0.36
105 0.38
106 0.42
107 0.4
108 0.41
109 0.45
110 0.46
111 0.46
112 0.43
113 0.37
114 0.39
115 0.44
116 0.5