Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8UPK9

Protein Details
Accession J8UPK9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-94VEWLRSRVKWNKESRPPVMRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 13, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR024156  Small_GTPase_ARF  
IPR006689  Small_GTPase_ARF/SAR  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF00025  Arf  
Amino Acid Sequences ECRLVLEDVLQSEDTEGVPLLILANKQDREDCVEVVRIKEGLVKRVFEGEKSHSIRDSRVLPVSALTGTGVREAVEWLRSRVKWNKESRPPVMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.06
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.08
11 0.13
12 0.14
13 0.15
14 0.17
15 0.17
16 0.22
17 0.24
18 0.22
19 0.19
20 0.22
21 0.23
22 0.22
23 0.22
24 0.15
25 0.14
26 0.17
27 0.17
28 0.19
29 0.19
30 0.19
31 0.19
32 0.24
33 0.24
34 0.2
35 0.22
36 0.2
37 0.27
38 0.28
39 0.29
40 0.26
41 0.27
42 0.27
43 0.27
44 0.26
45 0.21
46 0.21
47 0.21
48 0.18
49 0.18
50 0.18
51 0.14
52 0.12
53 0.09
54 0.07
55 0.07
56 0.08
57 0.07
58 0.06
59 0.07
60 0.08
61 0.09
62 0.12
63 0.14
64 0.16
65 0.23
66 0.24
67 0.31
68 0.38
69 0.46
70 0.51
71 0.6
72 0.67
73 0.72
74 0.8