Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PK50

Protein Details
Accession J3PK50   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-36AFACGRCHKRKVRCSGNPGDGSHydrophilic
97-123GYDLLPPRQLRRQQRRQFHRRRVGIAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MFLSFPSGPAHKRIAFACGRCHKRKVRCSGNPGDGSPCSNCESADPGTCQFPKARPAQQRRANKGLTRHTPLQVPSQPTSVGCDGEPGVGSQHMDCGYDLLPPRQLRRQQRRQFHRRRVGIAGAAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.38
4 0.43
5 0.47
6 0.54
7 0.57
8 0.64
9 0.66
10 0.7
11 0.77
12 0.77
13 0.78
14 0.79
15 0.81
16 0.82
17 0.81
18 0.73
19 0.65
20 0.59
21 0.48
22 0.42
23 0.34
24 0.28
25 0.22
26 0.19
27 0.18
28 0.15
29 0.18
30 0.17
31 0.18
32 0.18
33 0.16
34 0.19
35 0.2
36 0.2
37 0.18
38 0.19
39 0.22
40 0.26
41 0.32
42 0.38
43 0.46
44 0.55
45 0.62
46 0.69
47 0.7
48 0.7
49 0.66
50 0.59
51 0.58
52 0.56
53 0.52
54 0.49
55 0.45
56 0.41
57 0.4
58 0.39
59 0.39
60 0.35
61 0.34
62 0.3
63 0.28
64 0.27
65 0.24
66 0.27
67 0.21
68 0.17
69 0.13
70 0.13
71 0.12
72 0.12
73 0.12
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.09
80 0.09
81 0.1
82 0.09
83 0.1
84 0.1
85 0.13
86 0.15
87 0.15
88 0.21
89 0.23
90 0.28
91 0.35
92 0.43
93 0.51
94 0.6
95 0.69
96 0.73
97 0.81
98 0.88
99 0.9
100 0.93
101 0.93
102 0.93
103 0.88
104 0.84
105 0.79
106 0.73