Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZBW0

Protein Details
Accession A0A2C5ZBW0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
232-257NITWHGQELKRRFRWRRRPCLTVPGLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 6E.R. 6, extr 5, mito 4, pero 2, golg 2
Family & Domain DBs
Amino Acid Sequences MPNSKLLPLLLPLFTLLLTTSHATAPVFPPVVPITQPKIPPPEGDGTDRKPPVKDHHKPMNLTDHTGFNVTKYFYHEQEHMQREPAGGDTPNSALFPLVKDEFLQRHRPRYSPYLGFILNEIAEMQETIHRAVDRRENSTLHQSAALDLLSKAAKELRLARTAIPGMHKNMSNEIFQLIRALVIMIGLILDPIGLDPPPIHMTDHPWNTYAALSELLIVDYREVYQEPEKLNITWHGQELKRRFRWRRRPCLTVPGLSIGPYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.1
4 0.07
5 0.09
6 0.1
7 0.11
8 0.11
9 0.12
10 0.12
11 0.14
12 0.15
13 0.18
14 0.18
15 0.17
16 0.19
17 0.2
18 0.21
19 0.21
20 0.23
21 0.23
22 0.27
23 0.3
24 0.31
25 0.37
26 0.36
27 0.36
28 0.36
29 0.37
30 0.35
31 0.39
32 0.41
33 0.38
34 0.45
35 0.47
36 0.45
37 0.4
38 0.42
39 0.46
40 0.51
41 0.56
42 0.57
43 0.64
44 0.68
45 0.68
46 0.68
47 0.68
48 0.59
49 0.55
50 0.47
51 0.38
52 0.32
53 0.33
54 0.28
55 0.18
56 0.19
57 0.16
58 0.15
59 0.2
60 0.22
61 0.21
62 0.24
63 0.25
64 0.29
65 0.37
66 0.41
67 0.35
68 0.34
69 0.33
70 0.3
71 0.29
72 0.24
73 0.17
74 0.12
75 0.12
76 0.11
77 0.11
78 0.11
79 0.11
80 0.09
81 0.08
82 0.08
83 0.08
84 0.1
85 0.1
86 0.09
87 0.1
88 0.13
89 0.17
90 0.21
91 0.31
92 0.3
93 0.38
94 0.4
95 0.42
96 0.43
97 0.45
98 0.47
99 0.39
100 0.38
101 0.33
102 0.31
103 0.29
104 0.25
105 0.2
106 0.13
107 0.11
108 0.08
109 0.05
110 0.05
111 0.04
112 0.04
113 0.05
114 0.06
115 0.06
116 0.07
117 0.08
118 0.08
119 0.11
120 0.18
121 0.18
122 0.21
123 0.23
124 0.23
125 0.25
126 0.32
127 0.31
128 0.24
129 0.23
130 0.19
131 0.17
132 0.17
133 0.14
134 0.08
135 0.07
136 0.08
137 0.07
138 0.07
139 0.07
140 0.07
141 0.08
142 0.1
143 0.16
144 0.18
145 0.21
146 0.22
147 0.22
148 0.24
149 0.25
150 0.24
151 0.22
152 0.21
153 0.21
154 0.23
155 0.24
156 0.22
157 0.25
158 0.26
159 0.22
160 0.2
161 0.18
162 0.16
163 0.14
164 0.14
165 0.09
166 0.07
167 0.06
168 0.06
169 0.05
170 0.04
171 0.04
172 0.03
173 0.03
174 0.03
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.03
181 0.03
182 0.04
183 0.04
184 0.07
185 0.09
186 0.1
187 0.12
188 0.12
189 0.19
190 0.27
191 0.32
192 0.3
193 0.29
194 0.29
195 0.28
196 0.28
197 0.22
198 0.15
199 0.11
200 0.09
201 0.09
202 0.09
203 0.09
204 0.09
205 0.08
206 0.07
207 0.07
208 0.07
209 0.08
210 0.08
211 0.11
212 0.15
213 0.2
214 0.21
215 0.25
216 0.26
217 0.25
218 0.28
219 0.28
220 0.29
221 0.27
222 0.29
223 0.32
224 0.33
225 0.42
226 0.48
227 0.54
228 0.59
229 0.67
230 0.74
231 0.78
232 0.87
233 0.89
234 0.91
235 0.89
236 0.88
237 0.84
238 0.85
239 0.79
240 0.74
241 0.66
242 0.59
243 0.51