Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5XW36

Protein Details
Accession A0A2C5XW36    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-33APILHAIRPRRQRRTRTGTGTGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, extr 8, plas 6, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHQIVQRIRKLAPILHAIRPRRQRRTRTGTGTGPLMPSAAGDGSWSAVGVVARAHAVLSTQTFRFALHLCVAAAAVLGFFLGYHPLDPPSLFLVSSLALVGASTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.42
3 0.49
4 0.49
5 0.54
6 0.61
7 0.66
8 0.68
9 0.73
10 0.75
11 0.78
12 0.83
13 0.84
14 0.81
15 0.78
16 0.71
17 0.64
18 0.57
19 0.47
20 0.38
21 0.29
22 0.21
23 0.14
24 0.1
25 0.08
26 0.06
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.03
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.04
45 0.06
46 0.07
47 0.08
48 0.09
49 0.09
50 0.09
51 0.11
52 0.11
53 0.12
54 0.11
55 0.12
56 0.1
57 0.1
58 0.1
59 0.08
60 0.07
61 0.05
62 0.04
63 0.03
64 0.02
65 0.02
66 0.02
67 0.03
68 0.05
69 0.05
70 0.06
71 0.07
72 0.08
73 0.09
74 0.1
75 0.11
76 0.12
77 0.13
78 0.12
79 0.12
80 0.12
81 0.11
82 0.12
83 0.1
84 0.07
85 0.06