Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NYA1

Protein Details
Accession J3NYA1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
121-147FLSRVRTKNGRKILARRRAKGRSRLSGHydrophilic
NLS Segment(s)
PositionSequence
111-147SRLKRARTHGFLSRVRTKNGRKILARRRAKGRSRLSG
Subcellular Location(s) mito 21, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MASIAAIAPRLRMAAAPAQRIPGVVTRRLGGSQRHFSSLPSLRPTTCPRTSPLFRSSHSPLGFAPVAIAEQSQTASVLDLVPKTTITSHPALGGVASQIRCGPRPTVARTSRLKRARTHGFLSRVRTKNGRKILARRRAKGRSRLSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.23
3 0.27
4 0.27
5 0.29
6 0.29
7 0.29
8 0.27
9 0.26
10 0.25
11 0.24
12 0.25
13 0.23
14 0.25
15 0.27
16 0.29
17 0.29
18 0.33
19 0.38
20 0.39
21 0.41
22 0.4
23 0.39
24 0.43
25 0.42
26 0.39
27 0.35
28 0.35
29 0.32
30 0.37
31 0.43
32 0.42
33 0.4
34 0.37
35 0.35
36 0.42
37 0.44
38 0.45
39 0.46
40 0.41
41 0.38
42 0.43
43 0.44
44 0.43
45 0.4
46 0.35
47 0.28
48 0.29
49 0.28
50 0.22
51 0.17
52 0.09
53 0.09
54 0.08
55 0.08
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.07
72 0.08
73 0.11
74 0.12
75 0.12
76 0.13
77 0.13
78 0.12
79 0.11
80 0.1
81 0.07
82 0.09
83 0.08
84 0.08
85 0.1
86 0.11
87 0.13
88 0.15
89 0.15
90 0.19
91 0.24
92 0.3
93 0.38
94 0.4
95 0.46
96 0.52
97 0.57
98 0.61
99 0.63
100 0.62
101 0.58
102 0.64
103 0.66
104 0.64
105 0.64
106 0.62
107 0.62
108 0.63
109 0.65
110 0.66
111 0.6
112 0.59
113 0.62
114 0.62
115 0.64
116 0.68
117 0.69
118 0.66
119 0.73
120 0.79
121 0.81
122 0.83
123 0.81
124 0.82
125 0.83
126 0.85
127 0.84