Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5Z7Z2

Protein Details
Accession A0A2C5Z7Z2    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
68-92DDTARCDTRKRRHHTRGDIHHPRGTBasic
NLS Segment(s)
PositionSequence
77-83KRRHHTR
88-91HPRG
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MDRSESPRFLPTCGPVGPSKVKMPTTSDGFGSLFQARLMSESSLSPIRDPTVSTSPIACDTACDTDGDDTARCDTRKRRHHTRGDIHHPRGTRREPARGLAIADAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.26
3 0.3
4 0.33
5 0.32
6 0.33
7 0.34
8 0.35
9 0.34
10 0.38
11 0.37
12 0.37
13 0.35
14 0.31
15 0.28
16 0.26
17 0.24
18 0.22
19 0.17
20 0.12
21 0.11
22 0.11
23 0.09
24 0.09
25 0.1
26 0.08
27 0.08
28 0.08
29 0.1
30 0.12
31 0.13
32 0.12
33 0.11
34 0.12
35 0.11
36 0.12
37 0.14
38 0.15
39 0.16
40 0.16
41 0.16
42 0.15
43 0.16
44 0.16
45 0.11
46 0.08
47 0.09
48 0.1
49 0.11
50 0.1
51 0.09
52 0.09
53 0.1
54 0.11
55 0.09
56 0.08
57 0.1
58 0.14
59 0.14
60 0.19
61 0.27
62 0.36
63 0.46
64 0.54
65 0.63
66 0.7
67 0.8
68 0.85
69 0.86
70 0.87
71 0.88
72 0.89
73 0.84
74 0.78
75 0.71
76 0.66
77 0.64
78 0.58
79 0.57
80 0.53
81 0.57
82 0.56
83 0.58
84 0.58
85 0.51
86 0.47