Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YUU7

Protein Details
Accession A0A2C5YUU7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
64-91TSRHSTAKVKRLRSRRRQKAQNAKAGIKHydrophilic
NLS Segment(s)
PositionSequence
70-85AKVKRLRSRRRQKAQN
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MDGAKHNWLKPPALRRHDSNVQDWEEWEDVMVVTPIEPENSTTAAPTPSPPSGTRERTPTKSTTSRHSTAKVKRLRSRRRQKAQNAKAGIKLITDILSTQQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.58
3 0.64
4 0.67
5 0.64
6 0.6
7 0.56
8 0.51
9 0.47
10 0.43
11 0.38
12 0.3
13 0.26
14 0.2
15 0.13
16 0.1
17 0.09
18 0.09
19 0.05
20 0.04
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.08
27 0.09
28 0.09
29 0.08
30 0.09
31 0.09
32 0.09
33 0.1
34 0.11
35 0.11
36 0.13
37 0.14
38 0.17
39 0.23
40 0.28
41 0.29
42 0.33
43 0.38
44 0.4
45 0.43
46 0.41
47 0.41
48 0.44
49 0.44
50 0.45
51 0.47
52 0.46
53 0.46
54 0.49
55 0.51
56 0.51
57 0.58
58 0.57
59 0.59
60 0.64
61 0.71
62 0.77
63 0.79
64 0.83
65 0.85
66 0.89
67 0.9
68 0.93
69 0.93
70 0.92
71 0.9
72 0.86
73 0.78
74 0.71
75 0.63
76 0.53
77 0.42
78 0.33
79 0.25
80 0.19
81 0.16
82 0.13