Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5XIF6

Protein Details
Accession A0A2C5XIF6   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-107PRSLRRRTASHNAKRVPRRLRARARREMGDBasic
149-183VGRTPRPKIRRNQLNEPPRPESKFRRRQINKTWLPHydrophilic
478-497TSTSKTTTSKPPPPTPPPFLHydrophilic
NLS Segment(s)
PositionSequence
76-176KVPRSLRRRTASHNAKRVPRRLRARARREMGDDKTPTVEARRRKPTTTRARLRVETAKKMAVLAARKPKGEAIVGRTPRPKIRRNQLNEPPRPESKFRRRQ
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039182  Pop1  
IPR009723  Pop1_N  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF06978  POP1  
Amino Acid Sequences MPKKRNEPPTQPDVARQKRAKLQAARAIPVQPASAGLKDGELDLQAFVAAHEFEIRALEQSMAGSRAVGASRAFQKVPRSLRRRTASHNAKRVPRRLRARARREMGDDKTPTVEARRRKPTTTRARLRVETAKKMAVLAARKPKGEAIVGRTPRPKIRRNQLNEPPRPESKFRRRQINKTWLPTHAWHAKRARMTDPKNPLWRFAIPVTPNEKGYRLTHRSHGEKGTLVWDMSYMSTIGLYGPAAGVERVLRRLGVTQQSCWNERGGRRWRQGSRSWSGMLSRELKNGSGRRLVCPATIVWNALGADSADNEQSSKPAQHQVYLRVHPSAFLELFDELLRLTKMEKRRMYIEDLRFEIGSLELAGPASTEALLAILTPSAPEGNHAVVLRSLHGLTNPATLPSGALLTLDVDDPRVSSPSRPPLATPEAQMKLLRTIAEWPADNDTNPSSLFDRDARHHASCLPSQKTLNRRRASSSTSTSKTTTSKPPPPTPPPFLHHTFHTPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.71
3 0.68
4 0.67
5 0.68
6 0.75
7 0.76
8 0.73
9 0.73
10 0.72
11 0.73
12 0.68
13 0.63
14 0.56
15 0.48
16 0.41
17 0.32
18 0.23
19 0.21
20 0.2
21 0.18
22 0.16
23 0.15
24 0.14
25 0.14
26 0.14
27 0.12
28 0.1
29 0.1
30 0.08
31 0.08
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.06
38 0.08
39 0.08
40 0.08
41 0.1
42 0.1
43 0.1
44 0.11
45 0.11
46 0.1
47 0.11
48 0.13
49 0.12
50 0.12
51 0.1
52 0.09
53 0.11
54 0.11
55 0.12
56 0.1
57 0.14
58 0.19
59 0.23
60 0.24
61 0.25
62 0.32
63 0.38
64 0.47
65 0.53
66 0.55
67 0.59
68 0.68
69 0.72
70 0.71
71 0.71
72 0.73
73 0.73
74 0.76
75 0.79
76 0.76
77 0.78
78 0.81
79 0.82
80 0.8
81 0.79
82 0.79
83 0.8
84 0.84
85 0.85
86 0.86
87 0.88
88 0.85
89 0.8
90 0.76
91 0.74
92 0.67
93 0.65
94 0.57
95 0.48
96 0.44
97 0.39
98 0.33
99 0.33
100 0.34
101 0.33
102 0.41
103 0.5
104 0.52
105 0.56
106 0.63
107 0.67
108 0.72
109 0.75
110 0.75
111 0.74
112 0.77
113 0.74
114 0.72
115 0.71
116 0.67
117 0.63
118 0.57
119 0.5
120 0.43
121 0.41
122 0.36
123 0.31
124 0.28
125 0.28
126 0.35
127 0.36
128 0.36
129 0.36
130 0.36
131 0.33
132 0.33
133 0.29
134 0.26
135 0.33
136 0.35
137 0.39
138 0.42
139 0.43
140 0.47
141 0.51
142 0.51
143 0.51
144 0.6
145 0.65
146 0.69
147 0.76
148 0.79
149 0.82
150 0.81
151 0.78
152 0.73
153 0.67
154 0.64
155 0.6
156 0.6
157 0.61
158 0.64
159 0.64
160 0.7
161 0.72
162 0.77
163 0.82
164 0.82
165 0.79
166 0.76
167 0.73
168 0.64
169 0.61
170 0.54
171 0.5
172 0.48
173 0.42
174 0.41
175 0.42
176 0.44
177 0.44
178 0.45
179 0.46
180 0.47
181 0.5
182 0.51
183 0.55
184 0.58
185 0.63
186 0.6
187 0.55
188 0.49
189 0.45
190 0.4
191 0.33
192 0.33
193 0.25
194 0.29
195 0.31
196 0.29
197 0.29
198 0.27
199 0.27
200 0.23
201 0.25
202 0.29
203 0.29
204 0.3
205 0.35
206 0.4
207 0.42
208 0.43
209 0.42
210 0.35
211 0.3
212 0.29
213 0.24
214 0.19
215 0.16
216 0.12
217 0.1
218 0.09
219 0.08
220 0.08
221 0.05
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.03
229 0.03
230 0.03
231 0.03
232 0.03
233 0.04
234 0.05
235 0.06
236 0.07
237 0.07
238 0.07
239 0.07
240 0.09
241 0.13
242 0.19
243 0.19
244 0.19
245 0.26
246 0.28
247 0.3
248 0.29
249 0.27
250 0.24
251 0.25
252 0.32
253 0.35
254 0.41
255 0.44
256 0.52
257 0.54
258 0.56
259 0.61
260 0.59
261 0.54
262 0.48
263 0.44
264 0.37
265 0.33
266 0.3
267 0.27
268 0.25
269 0.22
270 0.22
271 0.21
272 0.21
273 0.26
274 0.27
275 0.26
276 0.28
277 0.28
278 0.27
279 0.31
280 0.3
281 0.24
282 0.23
283 0.2
284 0.19
285 0.18
286 0.17
287 0.13
288 0.13
289 0.13
290 0.12
291 0.11
292 0.06
293 0.06
294 0.06
295 0.07
296 0.05
297 0.05
298 0.06
299 0.06
300 0.07
301 0.08
302 0.09
303 0.1
304 0.18
305 0.18
306 0.22
307 0.25
308 0.32
309 0.37
310 0.39
311 0.38
312 0.33
313 0.32
314 0.29
315 0.27
316 0.22
317 0.16
318 0.13
319 0.13
320 0.11
321 0.12
322 0.11
323 0.1
324 0.06
325 0.07
326 0.07
327 0.06
328 0.08
329 0.13
330 0.2
331 0.29
332 0.32
333 0.34
334 0.39
335 0.42
336 0.49
337 0.52
338 0.51
339 0.47
340 0.46
341 0.44
342 0.39
343 0.35
344 0.28
345 0.19
346 0.13
347 0.09
348 0.07
349 0.06
350 0.06
351 0.05
352 0.05
353 0.05
354 0.05
355 0.04
356 0.04
357 0.03
358 0.04
359 0.04
360 0.03
361 0.04
362 0.03
363 0.03
364 0.03
365 0.04
366 0.05
367 0.05
368 0.06
369 0.08
370 0.09
371 0.12
372 0.12
373 0.12
374 0.13
375 0.14
376 0.14
377 0.13
378 0.13
379 0.11
380 0.11
381 0.13
382 0.12
383 0.16
384 0.15
385 0.14
386 0.14
387 0.13
388 0.13
389 0.11
390 0.11
391 0.07
392 0.06
393 0.06
394 0.06
395 0.07
396 0.07
397 0.07
398 0.07
399 0.08
400 0.08
401 0.09
402 0.11
403 0.11
404 0.14
405 0.22
406 0.3
407 0.34
408 0.34
409 0.34
410 0.4
411 0.46
412 0.44
413 0.39
414 0.38
415 0.37
416 0.38
417 0.38
418 0.32
419 0.29
420 0.29
421 0.26
422 0.19
423 0.21
424 0.23
425 0.25
426 0.24
427 0.22
428 0.27
429 0.28
430 0.27
431 0.26
432 0.23
433 0.21
434 0.21
435 0.21
436 0.17
437 0.17
438 0.2
439 0.21
440 0.24
441 0.27
442 0.34
443 0.38
444 0.38
445 0.38
446 0.39
447 0.4
448 0.42
449 0.46
450 0.44
451 0.42
452 0.46
453 0.52
454 0.58
455 0.63
456 0.67
457 0.65
458 0.64
459 0.67
460 0.68
461 0.68
462 0.66
463 0.64
464 0.63
465 0.6
466 0.6
467 0.54
468 0.52
469 0.49
470 0.47
471 0.49
472 0.49
473 0.55
474 0.6
475 0.68
476 0.73
477 0.78
478 0.81
479 0.78
480 0.76
481 0.71
482 0.7
483 0.66
484 0.6
485 0.56