FuNGI

A0A2C5XIF6

Protein Details

Accession

A0A2C5XIF6

Localization Confidence

High

Confidence Score

17.8

NoLS Segment(s)

Position	Sequence	Protein Nature
78-107	PRSLRRRTASHNAKRVPRRLRARARREMGD	Basic
149-183	VGRTPRPKIRRNQLNEPPRPESKFRRRQINKTWLP	Hydrophilic
478-497	TSTSKTTTSKPPPPTPPPFL	Hydrophilic

NLS Segment(s)

Position	Sequence
76-176	KVPRSLRRRTASHNAKRVPRRLRARARREMGDDKTPTVEARRRKPTTTRARLRVETAKKMAVLAARKPKGEAIVGRTPRPKIRRNQLNEPPRPESKFRRRQ

Subcellular Location(s)

nucl 13, mito 11, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR039182 Pop1 IPR009723 Pop1_N
Gene Ontology	GO:0005655 C:nucleolar ribonuclease P complex GO:0000172 C:ribonuclease MRP complex GO:0001682 P:tRNA 5'-leader removal
Pfam	View protein in Pfam PF06978 POP1

Amino Acid Sequences

MPKKRNEPPTQPDVARQKRAKLQAARAIPVQPASAGLKDGELDLQAFVAAHEFEIRALEQSMAGSRAVGASRAFQKVPRSLRRRTASHNAKRVPRRLRARARREMGDDKTPTVEARRRKPTTTRARLRVETAKKMAVLAARKPKGEAIVGRTPRPKIRRNQLNEPPRPESKFRRRQINKTWLPTHAWHAKRARMTDPKNPLWRFAIPVTPNEKGYRLTHRSHGEKGTLVWDMSYMSTIGLYGPAAGVERVLRRLGVTQQSCWNERGGRRWRQGSRSWSGMLSRELKNGSGRRLVCPATIVWNALGADSADNEQSSKPAQHQVYLRVHPSAFLELFDELLRLTKMEKRRMYIEDLRFEIGSLELAGPASTEALLAILTPSAPEGNHAVVLRSLHGLTNPATLPSGALLTLDVDDPRVSSPSRPPLATPEAQMKLLRTIAEWPADNDTNPSSLFDRDARHHASCLPSQKTLNRRRASSSTSTSKTTTSKPPPPTPPPFLHHTFHTPT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.71
2	0.71
3	0.68
4	0.67
5	0.68
6	0.75
7	0.76
8	0.73
9	0.73
10	0.72
11	0.73
12	0.68
13	0.63
14	0.56
15	0.48
16	0.41
17	0.32
18	0.23
19	0.21
20	0.2
21	0.18
22	0.16
23	0.15
24	0.14
25	0.14
26	0.14
27	0.12
28	0.1
29	0.1
30	0.08
31	0.08
32	0.08
33	0.07
34	0.07
35	0.07
36	0.07
37	0.06
38	0.08
39	0.08
40	0.08
41	0.1
42	0.1
43	0.1
44	0.11
45	0.11
46	0.1
47	0.11
48	0.13
49	0.12
50	0.12
51	0.1
52	0.09
53	0.11
54	0.11
55	0.12
56	0.1
57	0.14
58	0.19
59	0.23
60	0.24
61	0.25
62	0.32
63	0.38
64	0.47
65	0.53
66	0.55
67	0.59
68	0.68
69	0.72
70	0.71
71	0.71
72	0.73
73	0.73
74	0.76
75	0.79
76	0.76
77	0.78
78	0.81
79	0.82
80	0.8
81	0.79
82	0.79
83	0.8
84	0.84
85	0.85
86	0.86
87	0.88
88	0.85
89	0.8
90	0.76
91	0.74
92	0.67
93	0.65
94	0.57
95	0.48
96	0.44
97	0.39
98	0.33
99	0.33
100	0.34
101	0.33
102	0.41
103	0.5
104	0.52
105	0.56
106	0.63
107	0.67
108	0.72
109	0.75
110	0.75
111	0.74
112	0.77
113	0.74
114	0.72
115	0.71
116	0.67
117	0.63
118	0.57
119	0.5
120	0.43
121	0.41
122	0.36
123	0.31
124	0.28
125	0.28
126	0.35
127	0.36
128	0.36
129	0.36
130	0.36
131	0.33
132	0.33
133	0.29
134	0.26
135	0.33
136	0.35
137	0.39
138	0.42
139	0.43
140	0.47
141	0.51
142	0.51
143	0.51
144	0.6
145	0.65
146	0.69
147	0.76
148	0.79
149	0.82
150	0.81
151	0.78
152	0.73
153	0.67
154	0.64
155	0.6
156	0.6
157	0.61
158	0.64
159	0.64
160	0.7
161	0.72
162	0.77
163	0.82
164	0.82
165	0.79
166	0.76
167	0.73
168	0.64
169	0.61
170	0.54
171	0.5
172	0.48
173	0.42
174	0.41
175	0.42
176	0.44
177	0.44
178	0.45
179	0.46
180	0.47
181	0.5
182	0.51
183	0.55
184	0.58
185	0.63
186	0.6
187	0.55
188	0.49
189	0.45
190	0.4
191	0.33
192	0.33
193	0.25
194	0.29
195	0.31
196	0.29
197	0.29
198	0.27
199	0.27
200	0.23
201	0.25
202	0.29
203	0.29
204	0.3
205	0.35
206	0.4
207	0.42
208	0.43
209	0.42
210	0.35
211	0.3
212	0.29
213	0.24
214	0.19
215	0.16
216	0.12
217	0.1
218	0.09
219	0.08
220	0.08
221	0.05
222	0.04
223	0.04
224	0.04
225	0.04
226	0.04
227	0.04
228	0.03
229	0.03
230	0.03
231	0.03
232	0.03
233	0.04
234	0.05
235	0.06
236	0.07
237	0.07
238	0.07
239	0.07
240	0.09
241	0.13
242	0.19
243	0.19
244	0.19
245	0.26
246	0.28
247	0.3
248	0.29
249	0.27
250	0.24
251	0.25
252	0.32
253	0.35
254	0.41
255	0.44
256	0.52
257	0.54
258	0.56
259	0.61
260	0.59
261	0.54
262	0.48
263	0.44
264	0.37
265	0.33
266	0.3
267	0.27
268	0.25
269	0.22
270	0.22
271	0.21
272	0.21
273	0.26
274	0.27
275	0.26
276	0.28
277	0.28
278	0.27
279	0.31
280	0.3
281	0.24
282	0.23
283	0.2
284	0.19
285	0.18
286	0.17
287	0.13
288	0.13
289	0.13
290	0.12
291	0.11
292	0.06
293	0.06
294	0.06
295	0.07
296	0.05
297	0.05
298	0.06
299	0.06
300	0.07
301	0.08
302	0.09
303	0.1
304	0.18
305	0.18
306	0.22
307	0.25
308	0.32
309	0.37
310	0.39
311	0.38
312	0.33
313	0.32
314	0.29
315	0.27
316	0.22
317	0.16
318	0.13
319	0.13
320	0.11
321	0.12
322	0.11
323	0.1
324	0.06
325	0.07
326	0.07
327	0.06
328	0.08
329	0.13
330	0.2
331	0.29
332	0.32
333	0.34
334	0.39
335	0.42
336	0.49
337	0.52
338	0.51
339	0.47
340	0.46
341	0.44
342	0.39
343	0.35
344	0.28
345	0.19
346	0.13
347	0.09
348	0.07
349	0.06
350	0.06
351	0.05
352	0.05
353	0.05
354	0.05
355	0.04
356	0.04
357	0.03
358	0.04
359	0.04
360	0.03
361	0.04
362	0.03
363	0.03
364	0.03
365	0.04
366	0.05
367	0.05
368	0.06
369	0.08
370	0.09
371	0.12
372	0.12
373	0.12
374	0.13
375	0.14
376	0.14
377	0.13
378	0.13
379	0.11
380	0.11
381	0.13
382	0.12
383	0.16
384	0.15
385	0.14
386	0.14
387	0.13
388	0.13
389	0.11
390	0.11
391	0.07
392	0.06
393	0.06
394	0.06
395	0.07
396	0.07
397	0.07
398	0.07
399	0.08
400	0.08
401	0.09
402	0.11
403	0.11
404	0.14
405	0.22
406	0.3
407	0.34
408	0.34
409	0.34
410	0.4
411	0.46
412	0.44
413	0.39
414	0.38
415	0.37
416	0.38
417	0.38
418	0.32
419	0.29
420	0.29
421	0.26
422	0.19
423	0.21
424	0.23
425	0.25
426	0.24
427	0.22
428	0.27
429	0.28
430	0.27
431	0.26
432	0.23
433	0.21
434	0.21
435	0.21
436	0.17
437	0.17
438	0.2
439	0.21
440	0.24
441	0.27
442	0.34
443	0.38
444	0.38
445	0.38
446	0.39
447	0.4
448	0.42
449	0.46
450	0.44
451	0.42
452	0.46
453	0.52
454	0.58
455	0.63
456	0.67
457	0.65
458	0.64
459	0.67
460	0.68
461	0.68
462	0.66
463	0.64
464	0.63
465	0.6
466	0.6
467	0.54
468	0.52
469	0.49
470	0.47
471	0.49
472	0.49
473	0.55
474	0.6
475	0.68
476	0.73
477	0.78
478	0.81
479	0.78
480	0.76
481	0.71
482	0.7
483	0.66
484	0.6
485	0.56

A0A2C5XIF6

3D AlphaFold-predicted Structure Viewer