Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5XQ72

Protein Details
Accession A0A2C5XQ72    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-47VRDREERDRRDRDKTRRNRDKRDKAKARKAAAABasic
NLS Segment(s)
PositionSequence
21-46RDRRDRDKTRRNRDKRDKAKARKAAA
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MDAELQRQRDQEGFVRDREERDRRDRDKTRRNRDKRDKAKARKAAAAANKNSDPSVATYAEAPSPAPGFDHDINRPSVSAPTRNRPDDRDRDDEPATAEPATGLVIHDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.38
4 0.41
5 0.46
6 0.47
7 0.45
8 0.51
9 0.59
10 0.59
11 0.69
12 0.74
13 0.76
14 0.79
15 0.82
16 0.84
17 0.86
18 0.9
19 0.91
20 0.93
21 0.93
22 0.93
23 0.93
24 0.93
25 0.92
26 0.93
27 0.89
28 0.82
29 0.75
30 0.67
31 0.62
32 0.59
33 0.56
34 0.47
35 0.43
36 0.39
37 0.35
38 0.33
39 0.26
40 0.19
41 0.13
42 0.14
43 0.1
44 0.1
45 0.1
46 0.11
47 0.11
48 0.1
49 0.09
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.11
56 0.13
57 0.17
58 0.18
59 0.2
60 0.22
61 0.22
62 0.21
63 0.17
64 0.2
65 0.19
66 0.26
67 0.29
68 0.37
69 0.44
70 0.49
71 0.52
72 0.53
73 0.59
74 0.61
75 0.63
76 0.6
77 0.56
78 0.56
79 0.55
80 0.5
81 0.43
82 0.36
83 0.3
84 0.24
85 0.2
86 0.14
87 0.13
88 0.12
89 0.09
90 0.07