FuNGI

A0A2C5YKT2

Protein Details

Accession

A0A2C5YKT2

Localization Confidence

Medium

Confidence Score

10.3

NoLS Segment(s)

Position	Sequence	Protein Nature
518-539	RVSPEFRKRKTSSRKCDCPFGF	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 20.5, cyto_nucl 14, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR010061 MeMal-semiAld_DH
Gene Ontology	GO:0004491 F:methylmalonate-semialdehyde dehydrogenase (acylating) activity

Amino Acid Sequences

MSSLGPTGSNAHAGLSYSQQAGLRRNAGFAPSHTNQHQQNKQSPASHASSPYQPQAYAPQQQPPQGPYSQHLFAAPTSVNANGHPSSRAPNSHVPNAINVQRQRAVPPRQQMQAQSNPPPMMFPSGISQSVQHDAILSHAQHPQHPQHQQPHPSHQPHPGLPGHAQQQQQPTQQQQQQAQQQQQPTQQQQQQQPPSTQQQQHQQQHHALQHQQHQQHQSHAAHQVHQAHQAHTAHPGHAGHPGHPGHPSHQAHQAHQSRQSHQGHPHPQQQHKPPQQQQQQQPPQPPQAQQQPSQAQQHQQQQQQHLLTHQPQHQHQHQHPHQQAQQQQQQQQAAQQHTPQQQQRSQPTPPQVSQQQPPPQSHHTPQLPPQQMPQPPSQSQNQPKQQPQVPQVQQVQQGQQPQASPQQQPEQIPQQQDDAAADDMDMDSHNEAEPDGSGLDSKLLSDPSYVPTQPLGEMMSPPPEGGSYPTLEAVQKAVLRYCTSVGYAIVIGRSKKTVPGLKKVLFVCDRAGKPPSRVSPEFRKRKTSSRKCDCPFGFFAIEQRTQWTIRYRPDPAHLQHNHGPSQSPSNHPAARKLDSKMVAAVKQLKENGAGVTETLQILQNENPECHLLPRDIYNARAAINRNPQKVATGLAENRPAIYTKPQPSSEDRIRAELRRELAKARDDLKRIEEEKQKEIDELKAKVEEQEKTIHKFEMFIDICNQRVILQRERLEIDRPPAGENPAG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.16
2	0.16
3	0.18
4	0.16
5	0.18
6	0.2
7	0.24
8	0.28
9	0.32
10	0.34
11	0.32
12	0.34
13	0.33
14	0.33
15	0.31
16	0.28
17	0.32
18	0.28
19	0.34
20	0.35
21	0.41
22	0.46
23	0.54
24	0.6
25	0.59
26	0.64
27	0.66
28	0.69
29	0.67
30	0.63
31	0.59
32	0.55
33	0.51
34	0.47
35	0.43
36	0.43
37	0.43
38	0.45
39	0.4
40	0.36
41	0.33
42	0.38
43	0.41
44	0.42
45	0.41
46	0.43
47	0.45
48	0.51
49	0.53
50	0.47
51	0.46
52	0.41
53	0.41
54	0.36
55	0.38
56	0.35
57	0.32
58	0.29
59	0.26
60	0.22
61	0.24
62	0.2
63	0.15
64	0.15
65	0.16
66	0.16
67	0.15
68	0.2
69	0.17
70	0.18
71	0.19
72	0.19
73	0.23
74	0.28
75	0.31
76	0.32
77	0.39
78	0.44
79	0.48
80	0.51
81	0.46
82	0.45
83	0.47
84	0.47
85	0.46
86	0.42
87	0.41
88	0.41
89	0.41
90	0.43
91	0.47
92	0.5
93	0.49
94	0.56
95	0.56
96	0.56
97	0.59
98	0.59
99	0.58
100	0.59
101	0.58
102	0.56
103	0.56
104	0.52
105	0.48
106	0.43
107	0.36
108	0.32
109	0.26
110	0.2
111	0.19
112	0.21
113	0.22
114	0.21
115	0.21
116	0.19
117	0.22
118	0.21
119	0.16
120	0.14
121	0.13
122	0.15
123	0.18
124	0.16
125	0.16
126	0.19
127	0.2
128	0.22
129	0.29
130	0.33
131	0.37
132	0.42
133	0.47
134	0.53
135	0.6
136	0.66
137	0.66
138	0.68
139	0.7
140	0.7
141	0.67
142	0.66
143	0.63
144	0.56
145	0.57
146	0.49
147	0.42
148	0.39
149	0.4
150	0.36
151	0.36
152	0.36
153	0.34
154	0.4
155	0.42
156	0.45
157	0.44
158	0.45
159	0.48
160	0.51
161	0.53
162	0.5
163	0.52
164	0.56
165	0.58
166	0.59
167	0.55
168	0.56
169	0.54
170	0.55
171	0.55
172	0.52
173	0.54
174	0.52
175	0.55
176	0.58
177	0.63
178	0.65
179	0.61
180	0.58
181	0.55
182	0.57
183	0.59
184	0.56
185	0.51
186	0.53
187	0.6
188	0.65
189	0.65
190	0.63
191	0.59
192	0.6
193	0.6
194	0.54
195	0.48
196	0.45
197	0.48
198	0.51
199	0.5
200	0.49
201	0.51
202	0.49
203	0.48
204	0.5
205	0.43
206	0.4
207	0.44
208	0.4
209	0.35
210	0.38
211	0.39
212	0.34
213	0.4
214	0.37
215	0.3
216	0.35
217	0.33
218	0.3
219	0.3
220	0.3
221	0.23
222	0.23
223	0.23
224	0.18
225	0.23
226	0.24
227	0.18
228	0.23
229	0.24
230	0.22
231	0.24
232	0.25
233	0.21
234	0.3
235	0.31
236	0.27
237	0.35
238	0.36
239	0.35
240	0.43
241	0.47
242	0.41
243	0.46
244	0.47
245	0.42
246	0.49
247	0.52
248	0.48
249	0.47
250	0.53
251	0.54
252	0.57
253	0.62
254	0.6
255	0.62
256	0.65
257	0.68
258	0.69
259	0.7
260	0.74
261	0.73
262	0.75
263	0.78
264	0.79
265	0.78
266	0.79
267	0.79
268	0.74
269	0.73
270	0.67
271	0.65
272	0.6
273	0.55
274	0.49
275	0.5
276	0.49
277	0.46
278	0.49
279	0.46
280	0.46
281	0.49
282	0.45
283	0.4
284	0.42
285	0.48
286	0.46
287	0.47
288	0.48
289	0.46
290	0.49
291	0.46
292	0.4
293	0.33
294	0.31
295	0.3
296	0.31
297	0.31
298	0.29
299	0.31
300	0.37
301	0.41
302	0.44
303	0.44
304	0.49
305	0.51
306	0.57
307	0.56
308	0.56
309	0.54
310	0.52
311	0.55
312	0.52
313	0.54
314	0.49
315	0.51
316	0.49
317	0.46
318	0.41
319	0.39
320	0.36
321	0.31
322	0.27
323	0.25
324	0.28
325	0.31
326	0.36
327	0.36
328	0.36
329	0.38
330	0.43
331	0.48
332	0.45
333	0.43
334	0.42
335	0.46
336	0.45
337	0.41
338	0.39
339	0.38
340	0.38
341	0.38
342	0.41
343	0.41
344	0.4
345	0.41
346	0.41
347	0.41
348	0.42
349	0.41
350	0.41
351	0.38
352	0.36
353	0.41
354	0.45
355	0.43
356	0.39
357	0.39
358	0.38
359	0.37
360	0.38
361	0.36
362	0.32
363	0.31
364	0.34
365	0.35
366	0.37
367	0.42
368	0.48
369	0.51
370	0.51
371	0.53
372	0.56
373	0.57
374	0.54
375	0.51
376	0.52
377	0.46
378	0.46
379	0.46
380	0.43
381	0.43
382	0.39
383	0.37
384	0.3
385	0.31
386	0.26
387	0.24
388	0.21
389	0.18
390	0.23
391	0.24
392	0.23
393	0.22
394	0.27
395	0.29
396	0.3
397	0.32
398	0.33
399	0.33
400	0.33
401	0.31
402	0.27
403	0.24
404	0.23
405	0.2
406	0.14
407	0.11
408	0.09
409	0.08
410	0.06
411	0.06
412	0.06
413	0.06
414	0.04
415	0.04
416	0.04
417	0.05
418	0.05
419	0.05
420	0.05
421	0.05
422	0.05
423	0.05
424	0.04
425	0.04
426	0.04
427	0.05
428	0.05
429	0.05
430	0.06
431	0.06
432	0.07
433	0.08
434	0.09
435	0.11
436	0.14
437	0.14
438	0.13
439	0.13
440	0.14
441	0.13
442	0.12
443	0.11
444	0.08
445	0.1
446	0.1
447	0.12
448	0.11
449	0.11
450	0.1
451	0.09
452	0.09
453	0.1
454	0.11
455	0.1
456	0.1
457	0.11
458	0.12
459	0.12
460	0.12
461	0.1
462	0.11
463	0.11
464	0.11
465	0.12
466	0.13
467	0.14
468	0.15
469	0.15
470	0.13
471	0.13
472	0.13
473	0.11
474	0.1
475	0.1
476	0.09
477	0.09
478	0.11
479	0.11
480	0.11
481	0.13
482	0.12
483	0.15
484	0.21
485	0.27
486	0.29
487	0.38
488	0.45
489	0.46
490	0.51
491	0.49
492	0.5
493	0.44
494	0.41
495	0.36
496	0.35
497	0.34
498	0.31
499	0.36
500	0.31
501	0.33
502	0.39
503	0.4
504	0.41
505	0.43
506	0.46
507	0.53
508	0.61
509	0.68
510	0.65
511	0.69
512	0.65
513	0.72
514	0.77
515	0.77
516	0.78
517	0.78
518	0.84
519	0.78
520	0.84
521	0.75
522	0.69
523	0.61
524	0.55
525	0.46
526	0.36
527	0.38
528	0.33
529	0.33
530	0.27
531	0.27
532	0.25
533	0.23
534	0.27
535	0.29
536	0.29
537	0.34
538	0.4
539	0.41
540	0.42
541	0.47
542	0.51
543	0.47
544	0.52
545	0.47
546	0.48
547	0.5
548	0.51
549	0.48
550	0.41
551	0.4
552	0.31
553	0.37
554	0.34
555	0.33
556	0.32
557	0.37
558	0.4
559	0.39
560	0.45
561	0.42
562	0.44
563	0.44
564	0.43
565	0.43
566	0.41
567	0.41
568	0.39
569	0.37
570	0.33
571	0.33
572	0.38
573	0.33
574	0.35
575	0.35
576	0.31
577	0.29
578	0.29
579	0.25
580	0.18
581	0.16
582	0.12
583	0.12
584	0.12
585	0.11
586	0.11
587	0.12
588	0.11
589	0.13
590	0.15
591	0.18
592	0.19
593	0.2
594	0.2
595	0.2
596	0.2
597	0.21
598	0.22
599	0.18
600	0.18
601	0.21
602	0.26
603	0.25
604	0.26
605	0.27
606	0.25
607	0.25
608	0.28
609	0.28
610	0.29
611	0.39
612	0.45
613	0.45
614	0.46
615	0.45
616	0.42
617	0.4
618	0.36
619	0.28
620	0.27
621	0.28
622	0.3
623	0.34
624	0.32
625	0.32
626	0.3
627	0.27
628	0.23
629	0.27
630	0.31
631	0.34
632	0.41
633	0.43
634	0.47
635	0.52
636	0.59
637	0.6
638	0.6
639	0.55
640	0.55
641	0.57
642	0.58
643	0.57
644	0.53
645	0.49
646	0.45
647	0.46
648	0.44
649	0.45
650	0.46
651	0.45
652	0.45
653	0.48
654	0.46
655	0.47
656	0.47
657	0.5
658	0.47
659	0.5
660	0.53
661	0.51
662	0.54
663	0.55
664	0.51
665	0.46
666	0.46
667	0.45
668	0.43
669	0.4
670	0.37
671	0.36
672	0.35
673	0.38
674	0.41
675	0.36
676	0.31
677	0.38
678	0.39
679	0.42
680	0.44
681	0.42
682	0.36
683	0.36
684	0.34
685	0.36
686	0.32
687	0.28
688	0.32
689	0.31
690	0.32
691	0.31
692	0.3
693	0.22
694	0.29
695	0.33
696	0.35
697	0.41
698	0.44
699	0.48
700	0.52
701	0.52
702	0.48
703	0.47
704	0.45
705	0.41
706	0.39
707	0.37
708	0.36

A0A2C5YKT2

3D AlphaFold-predicted Structure Viewer