Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5YZZ0

Protein Details
Accession A0A2C5YZZ0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-89SELDKRAPKKGKKGKKGGKKGKKGKKGAKAAKAATBasic
NLS Segment(s)
PositionSequence
59-87KRAPKKGKKGKKGGKKGKKGKKGAKAAKA
Subcellular Location(s) extr 23, vacu 2
Family & Domain DBs
Amino Acid Sequences MKFSQVFLNAIFASSAAAVALSPGQQGAGQDLAQRSVGIEGAVADPSIAARNVDSELDKRAPKKGKKGKKGGKKGKKGKKGAKAAKAATANAATAKDNGNGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.05
4 0.04
5 0.04
6 0.04
7 0.05
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.06
14 0.07
15 0.08
16 0.08
17 0.1
18 0.11
19 0.12
20 0.11
21 0.11
22 0.09
23 0.08
24 0.08
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.04
32 0.04
33 0.04
34 0.05
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.06
41 0.07
42 0.07
43 0.11
44 0.14
45 0.16
46 0.17
47 0.24
48 0.32
49 0.36
50 0.47
51 0.54
52 0.61
53 0.69
54 0.79
55 0.81
56 0.83
57 0.89
58 0.9
59 0.9
60 0.91
61 0.91
62 0.91
63 0.91
64 0.91
65 0.89
66 0.88
67 0.88
68 0.87
69 0.85
70 0.82
71 0.74
72 0.71
73 0.64
74 0.55
75 0.47
76 0.39
77 0.31
78 0.24
79 0.24
80 0.17
81 0.17
82 0.18