Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5YPJ7

Protein Details
Accession A0A2C5YPJ7    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MLCPMKARKRYNPPQAKISSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035439  UPF0145_dom_sf  
IPR002765  UPF0145_YbjQ-like  
Pfam View protein in Pfam  
PF01906  YbjQ_1  
Amino Acid Sequences MLCPMKARKRYNPPQAKISSTAKSKAASDDVGGLPPPQLSDLRGFDDTKGVITTTMMDLPGYRVVRVLGTVYGISVRSRNVAASLGMALKSLIGGELSWFTTMLYSSRNDSVSRAIEECERRGGNAIICLRFDAGAIDGFAQTAAYGTACVVEKVDDNVQPPPQLEGASGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.73
4 0.69
5 0.64
6 0.6
7 0.53
8 0.52
9 0.45
10 0.42
11 0.38
12 0.36
13 0.33
14 0.27
15 0.23
16 0.23
17 0.21
18 0.2
19 0.19
20 0.16
21 0.13
22 0.12
23 0.12
24 0.09
25 0.09
26 0.1
27 0.14
28 0.16
29 0.19
30 0.21
31 0.22
32 0.2
33 0.22
34 0.2
35 0.17
36 0.15
37 0.11
38 0.09
39 0.09
40 0.09
41 0.08
42 0.08
43 0.08
44 0.07
45 0.07
46 0.09
47 0.14
48 0.13
49 0.12
50 0.11
51 0.12
52 0.12
53 0.12
54 0.11
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.07
71 0.07
72 0.07
73 0.06
74 0.06
75 0.05
76 0.04
77 0.04
78 0.04
79 0.03
80 0.03
81 0.02
82 0.03
83 0.04
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.06
91 0.07
92 0.07
93 0.09
94 0.12
95 0.13
96 0.13
97 0.14
98 0.18
99 0.18
100 0.19
101 0.17
102 0.16
103 0.21
104 0.23
105 0.23
106 0.25
107 0.23
108 0.21
109 0.23
110 0.24
111 0.2
112 0.23
113 0.26
114 0.22
115 0.22
116 0.22
117 0.2
118 0.18
119 0.17
120 0.11
121 0.08
122 0.08
123 0.08
124 0.08
125 0.07
126 0.07
127 0.07
128 0.06
129 0.05
130 0.05
131 0.05
132 0.04
133 0.04
134 0.04
135 0.07
136 0.07
137 0.08
138 0.08
139 0.09
140 0.1
141 0.14
142 0.18
143 0.18
144 0.19
145 0.24
146 0.26
147 0.27
148 0.26
149 0.25
150 0.23
151 0.21