Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P8G3

Protein Details
Accession J3P8G3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-49GQAMPRCRRPLQRRRKARSVPPSKKVHydrophilic
NLS Segment(s)
PositionSequence
32-47RPLQRRRKARSVPPSK
Subcellular Location(s) mito 9, nucl 8, cysk 7, cyto 2
Family & Domain DBs
Amino Acid Sequences MQTWGGDTSQIGFAAMSPPLAGEGQAMPRCRRPLQRRRKARSVPPSKKVISEAVKTLRLSHDVFHCRFRHVPLSWSGRCWEAGILGNLGEHEDYLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.06
5 0.06
6 0.07
7 0.07
8 0.07
9 0.06
10 0.07
11 0.14
12 0.17
13 0.2
14 0.21
15 0.26
16 0.31
17 0.34
18 0.43
19 0.48
20 0.55
21 0.64
22 0.72
23 0.78
24 0.82
25 0.88
26 0.85
27 0.85
28 0.85
29 0.85
30 0.83
31 0.77
32 0.75
33 0.65
34 0.59
35 0.51
36 0.46
37 0.39
38 0.32
39 0.31
40 0.28
41 0.3
42 0.29
43 0.28
44 0.23
45 0.22
46 0.21
47 0.19
48 0.24
49 0.27
50 0.29
51 0.35
52 0.34
53 0.35
54 0.37
55 0.38
56 0.38
57 0.33
58 0.35
59 0.36
60 0.43
61 0.4
62 0.41
63 0.38
64 0.32
65 0.31
66 0.29
67 0.21
68 0.15
69 0.18
70 0.17
71 0.17
72 0.15
73 0.15
74 0.14
75 0.14
76 0.11