FuNGI

A0A2C5Z247

Protein Details

Accession

A0A2C5Z247

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
72-94	ALTWYNRSRNKRPWAISKTRAFY	Hydrophilic
474-493	VISKGPPSPKKANGRARRRL	Hydrophilic

NLS Segment(s)

Position	Sequence
477-493	KGPPSPKKANGRARRRL

Subcellular Location(s)

plas 17, mito 6, E.R. 2

Family & Domain DBs

InterPro	View protein in InterPro IPR002076 ELO_fam
Gene Ontology	GO:0016020 C:membrane GO:0009922 F:fatty acid elongase activity GO:0102756 F:very-long-chain 3-ketoacyl-CoA synthase activity GO:0006633 P:fatty acid biosynthetic process
Pfam	View protein in Pfam PF01151 ELO

Amino Acid Sequences

MAIFNYHHAAITIPKFSQFSFPPTGQPPPLAPTPTPSSIMRPFNIPENIYAAALDPRVPLTIATVYAITATALTWYNRSRNKRPWAISKTRAFYAFVILHNVALAVYSAWTFWGMLGVMHRSVRYPWRPGGLPAMLDGFCRMHGPGRLGASLYYHEDSGRWLSADASSMVDALDASGTPIGTPMGRIWSEGLDYYGWIFYLSKFYEVLDTFIILAKGKPSSILQTYHHSGAMMCMWAGMRFMSAPIWMFATVNSLIHAFMYTYYTLTALTIKVPMRIKRTLTTMQIIQFILGAFFATLHLFVTYLTPITIPRRDGPGMPASPTDSGIPVASGVFGSVKQLLFGPVLDETSPVISMSPLQPSSSMMTETVYVAQQCIVTRGETFAIWLNTIYLAPLTYLFVSFFIASYVKRREAGQKANGKAKRNDNVTMAEKAGWDAARGVGKVVYGSDGSISPITPISPASSVSPASPASPVVISKGPPSPKKANGRARRRL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.26
3	0.26
4	0.32
5	0.28
6	0.31
7	0.34
8	0.35
9	0.38
10	0.41
11	0.46
12	0.41
13	0.41
14	0.36
15	0.35
16	0.39
17	0.37
18	0.33
19	0.33
20	0.37
21	0.37
22	0.39
23	0.35
24	0.37
25	0.4
26	0.46
27	0.41
28	0.38
29	0.37
30	0.41
31	0.45
32	0.39
33	0.32
34	0.31
35	0.31
36	0.26
37	0.25
38	0.18
39	0.16
40	0.15
41	0.15
42	0.11
43	0.11
44	0.12
45	0.12
46	0.11
47	0.11
48	0.13
49	0.12
50	0.12
51	0.12
52	0.11
53	0.11
54	0.11
55	0.08
56	0.06
57	0.05
58	0.06
59	0.09
60	0.09
61	0.13
62	0.17
63	0.25
64	0.33
65	0.42
66	0.49
67	0.57
68	0.67
69	0.72
70	0.76
71	0.78
72	0.8
73	0.82
74	0.82
75	0.8
76	0.74
77	0.68
78	0.62
79	0.54
80	0.44
81	0.41
82	0.35
83	0.27
84	0.28
85	0.25
86	0.23
87	0.21
88	0.2
89	0.13
90	0.1
91	0.09
92	0.04
93	0.04
94	0.04
95	0.04
96	0.05
97	0.05
98	0.05
99	0.05
100	0.06
101	0.06
102	0.06
103	0.08
104	0.1
105	0.11
106	0.12
107	0.13
108	0.12
109	0.15
110	0.24
111	0.27
112	0.31
113	0.32
114	0.36
115	0.37
116	0.38
117	0.41
118	0.34
119	0.29
120	0.24
121	0.24
122	0.19
123	0.18
124	0.18
125	0.11
126	0.1
127	0.11
128	0.1
129	0.11
130	0.13
131	0.16
132	0.18
133	0.19
134	0.19
135	0.19
136	0.19
137	0.17
138	0.16
139	0.17
140	0.14
141	0.12
142	0.12
143	0.12
144	0.13
145	0.14
146	0.13
147	0.1
148	0.1
149	0.1
150	0.1
151	0.12
152	0.11
153	0.09
154	0.08
155	0.08
156	0.07
157	0.07
158	0.06
159	0.05
160	0.04
161	0.03
162	0.04
163	0.04
164	0.04
165	0.04
166	0.04
167	0.05
168	0.04
169	0.05
170	0.05
171	0.09
172	0.09
173	0.1
174	0.1
175	0.1
176	0.11
177	0.1
178	0.11
179	0.07
180	0.07
181	0.07
182	0.06
183	0.06
184	0.06
185	0.06
186	0.05
187	0.1
188	0.1
189	0.11
190	0.11
191	0.11
192	0.14
193	0.14
194	0.15
195	0.11
196	0.1
197	0.1
198	0.1
199	0.11
200	0.07
201	0.07
202	0.07
203	0.07
204	0.07
205	0.08
206	0.08
207	0.11
208	0.13
209	0.16
210	0.17
211	0.21
212	0.24
213	0.24
214	0.23
215	0.2
216	0.17
217	0.15
218	0.13
219	0.08
220	0.06
221	0.05
222	0.05
223	0.05
224	0.05
225	0.04
226	0.04
227	0.04
228	0.04
229	0.04
230	0.05
231	0.05
232	0.05
233	0.06
234	0.06
235	0.06
236	0.05
237	0.08
238	0.08
239	0.08
240	0.08
241	0.07
242	0.07
243	0.07
244	0.07
245	0.04
246	0.04
247	0.06
248	0.06
249	0.06
250	0.06
251	0.06
252	0.06
253	0.06
254	0.07
255	0.05
256	0.06
257	0.09
258	0.1
259	0.15
260	0.19
261	0.22
262	0.26
263	0.3
264	0.32
265	0.3
266	0.35
267	0.35
268	0.33
269	0.32
270	0.3
271	0.28
272	0.28
273	0.26
274	0.2
275	0.16
276	0.13
277	0.11
278	0.08
279	0.06
280	0.03
281	0.04
282	0.04
283	0.04
284	0.04
285	0.04
286	0.04
287	0.04
288	0.04
289	0.05
290	0.05
291	0.05
292	0.05
293	0.06
294	0.07
295	0.12
296	0.14
297	0.15
298	0.17
299	0.21
300	0.22
301	0.23
302	0.25
303	0.28
304	0.26
305	0.25
306	0.24
307	0.21
308	0.21
309	0.21
310	0.18
311	0.11
312	0.11
313	0.09
314	0.09
315	0.07
316	0.06
317	0.06
318	0.05
319	0.05
320	0.04
321	0.04
322	0.06
323	0.08
324	0.08
325	0.08
326	0.09
327	0.1
328	0.1
329	0.1
330	0.09
331	0.08
332	0.09
333	0.08
334	0.08
335	0.08
336	0.08
337	0.08
338	0.07
339	0.06
340	0.06
341	0.07
342	0.09
343	0.12
344	0.12
345	0.12
346	0.13
347	0.14
348	0.17
349	0.16
350	0.15
351	0.11
352	0.12
353	0.12
354	0.12
355	0.12
356	0.11
357	0.1
358	0.09
359	0.1
360	0.11
361	0.1
362	0.12
363	0.12
364	0.11
365	0.11
366	0.13
367	0.13
368	0.11
369	0.12
370	0.14
371	0.14
372	0.14
373	0.13
374	0.12
375	0.12
376	0.12
377	0.11
378	0.06
379	0.06
380	0.06
381	0.06
382	0.07
383	0.07
384	0.08
385	0.08
386	0.08
387	0.09
388	0.09
389	0.08
390	0.09
391	0.09
392	0.1
393	0.16
394	0.21
395	0.22
396	0.23
397	0.26
398	0.34
399	0.41
400	0.5
401	0.52
402	0.56
403	0.59
404	0.68
405	0.71
406	0.68
407	0.67
408	0.68
409	0.67
410	0.63
411	0.61
412	0.55
413	0.56
414	0.53
415	0.48
416	0.4
417	0.33
418	0.28
419	0.25
420	0.25
421	0.18
422	0.15
423	0.13
424	0.15
425	0.17
426	0.17
427	0.17
428	0.15
429	0.15
430	0.14
431	0.14
432	0.12
433	0.1
434	0.1
435	0.1
436	0.1
437	0.12
438	0.12
439	0.11
440	0.11
441	0.11
442	0.11
443	0.1
444	0.11
445	0.12
446	0.12
447	0.14
448	0.15
449	0.18
450	0.18
451	0.18
452	0.2
453	0.18
454	0.18
455	0.18
456	0.15
457	0.15
458	0.16
459	0.15
460	0.17
461	0.19
462	0.19
463	0.22
464	0.29
465	0.35
466	0.39
467	0.47
468	0.51
469	0.58
470	0.67
471	0.74
472	0.77
473	0.79

A0A2C5Z247

3D AlphaFold-predicted Structure Viewer