Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZM03

Protein Details
Accession A0A2C5ZM03    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRKNNGRNKKGRGHVKPIRCSNCSHydrophilic
102-126RSRVGRRNRAPPPRVRYNKDGKKIVBasic
NLS Segment(s)
PositionSequence
3-19KKRKNNGRNKKGRGHVK
104-124RVGRRNRAPPPRVRYNKDGKK
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRKNNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRYVVSPRERDNCALAAVRSRVGRRNRAPPPRVRYNKDGKKIVPTVAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.86
4 0.83
5 0.82
6 0.83
7 0.83
8 0.81
9 0.73
10 0.72
11 0.7
12 0.7
13 0.69
14 0.67
15 0.64
16 0.65
17 0.69
18 0.7
19 0.72
20 0.71
21 0.73
22 0.74
23 0.76
24 0.72
25 0.73
26 0.69
27 0.69
28 0.61
29 0.53
30 0.46
31 0.38
32 0.35
33 0.28
34 0.25
35 0.16
36 0.15
37 0.12
38 0.1
39 0.1
40 0.08
41 0.08
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.1
55 0.16
56 0.18
57 0.19
58 0.21
59 0.22
60 0.23
61 0.25
62 0.23
63 0.18
64 0.18
65 0.16
66 0.17
67 0.18
68 0.18
69 0.18
70 0.19
71 0.17
72 0.17
73 0.19
74 0.22
75 0.28
76 0.29
77 0.3
78 0.34
79 0.35
80 0.36
81 0.36
82 0.29
83 0.24
84 0.24
85 0.21
86 0.21
87 0.2
88 0.21
89 0.22
90 0.23
91 0.29
92 0.35
93 0.44
94 0.46
95 0.55
96 0.62
97 0.7
98 0.75
99 0.77
100 0.79
101 0.8
102 0.83
103 0.79
104 0.78
105 0.79
106 0.81
107 0.81
108 0.8
109 0.71
110 0.71
111 0.68
112 0.66