Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZBY4

Protein Details
Accession A0A2C5ZBY4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
14-42GLLWKIPWRLSKFQKRRHRQRLRAVDEVVHydrophilic
77-103KYTIFDRKARRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-96KARRYRKGIHKLP
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGPFRITNPLSGGLLWKIPWRLSKFQKRRHRQRLRAVDEVVATVNAAMAAKGQTVEALERWNAEMPTEAEMLPRDKYTIFDRKARRYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.26
8 0.3
9 0.38
10 0.47
11 0.57
12 0.63
13 0.72
14 0.8
15 0.84
16 0.89
17 0.92
18 0.93
19 0.91
20 0.92
21 0.93
22 0.89
23 0.83
24 0.73
25 0.64
26 0.52
27 0.43
28 0.32
29 0.21
30 0.14
31 0.08
32 0.06
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.07
49 0.09
50 0.09
51 0.08
52 0.1
53 0.09
54 0.11
55 0.12
56 0.11
57 0.1
58 0.12
59 0.13
60 0.12
61 0.12
62 0.11
63 0.1
64 0.13
65 0.19
66 0.27
67 0.29
68 0.36
69 0.43
70 0.53
71 0.63
72 0.69
73 0.7
74 0.69
75 0.76
76 0.79
77 0.83
78 0.82
79 0.83
80 0.84
81 0.86
82 0.87
83 0.87
84 0.82
85 0.79
86 0.79
87 0.79
88 0.8
89 0.77
90 0.79